KEGG   Bordetella pertussis Tohama I: BP3418Help
Entry
BP3418            CDS       T00139                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BP3418 (ruvA)
Enzymes [BR:bpe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BP3418 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3626246..3626818
Genome map
AA seq 190 aa AA seqDB search
MIGRITGTLIEKSPPVVCVDVNGVGYEIDVPMSTLYALPETGARVTLFTHLVVREDAQLL
YGFGSSAERSTFRELIKVTGIGARTALAVLSGLSVAELSQAITLQETGRLTRVPGIGKKT
AERLLLEMRGKLGADIGATPHAASGHQSDILNALLALGYSDKESQAALKKLPDGVDVSEG
IRLALKALVR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcattaccggaaccctcatcgagaaatcgccgcccgtcgtctgtgtcgac
gtcaacggagtgggctatgaaatcgatgtccccatgagcaccctgtatgcgctgcccgag
accggcgcgcgggtcaccctgttcacccacctggtggtgcgcgaggatgcgcagctgctg
tacgggttcggcagcagcgccgagcgcagcacgttccgcgagctgatcaaggtgaccggc
atcggcgcgcgcaccgcgctggcggtcctgtcggggctctcggtggccgagctgtcgcag
gccatcacgctgcaggagaccgggcgcctgacgcgcgtgccgggcatcggcaagaagacc
gcggagcgcctgctgctggagatgcgcggcaagctgggcgcggacatcggcgccaccccg
cacgcggccagcggccaccagagcgatatcctcaacgcgctgctggcgctgggctactcc
gacaaggaatcccaggcggcgctcaagaagctgcccgacggggtggacgtgtcggaaggc
atccgcctggcgctcaaggccctggtccgctag

DBGET integrated database retrieval system