KEGG   Bordetella pertussis Tohama I: BP3589Help
Entry
BP3589            CDS       T00139                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00260  Glycine, serine and threonine metabolism
bpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpe01100  Metabolic pathways
bpe01110  Biosynthesis of secondary metabolites
bpe01130  Biosynthesis of antibiotics
bpe01230  Biosynthesis of amino acids
Module
bpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BP3589 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BP3589 (trpB)
Enzymes [BR:bpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BP3589 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 2665249
NCBI-ProteinID: NP_882102
UniProt: Q7VTF1
Position
3802752..3803951
Genome map
AA seq 399 aa AA seqDB search
MKPYDLPDARGHFGPYGGVFVAETLMHALDELRAAYDQCRVDPSFIDEFNYELKHFVGRP
SPVYHASRWSQRLGGAQIWFKREDLNHTGAHKVNNCIGQALLARRMGKPRVIAETGAGQH
GVATATVAARYGMECVVFMGSEDVRRQASNVYRMKLLGATVVPVDSGSCTLKDALNEAMR
DWVTNIENTFYIIGTVAGPDPYPRMVRDFQTVIGQECLTQMPEVIGRQPDYVVAAVGGGS
NAMGIFHPYIPYENVRLIGVEAAGEGMETGRHAASLAAGQIGVLHGNRTYVMQNADGQVQ
ETHSVSAGLDYPGVGPEHAWLKDSGRAEYAGITDDEALAAFHDCCRIEGIMPALESAHAI
AQAVKMTPALSKDKVILVNLSGRGDKDMHTVAERAGLQL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccttacgaccttccggatgcccggggccatttcggcccctatggcggtgtgttt
gtggcggaaacgctgatgcacgccctagacgagctgcgcgcggcctatgaccagtgccgc
gtcgatcccagcttcatcgacgagttcaattacgagctcaagcatttcgtcggccggccc
agcccggtctaccacgccagccgctggtcgcagcgcctgggcggcgcgcagatctggttc
aagcgcgaagacctcaaccatacgggcgcgcacaaggtcaacaattgcatcggccaggcg
ctgctggcgcggcgcatgggcaagccgcgcgtcatcgccgagaccggcgccggccagcac
ggcgtggccacggccacggtggcggcccgctatggcatggaatgcgtggtgttcatgggc
agcgaggacgtgcgccgccaggcctccaacgtctatcgcatgaagctgctgggcgccacg
gtggtgccggtggactcgggctcgtgcaccctgaaggacgcgctgaacgaagccatgcgc
gactgggtcaccaacatcgagaatacgttctacatcatcggcacggtggccgggcccgac
ccctacccgcgcatggtgcgcgacttccagaccgtcatcggccaggagtgcctgacccag
atgcccgaagtcatcggccgccagcccgactatgtggtcgcggcggtgggcggcggctcc
aacgccatgggcattttccatccctacatcccgtacgagaacgtgcgcctgatcggcgtc
gaggcggcgggcgagggcatggaaaccggccgccatgcggcgtcgctggcggcgggccag
atcggcgtgctgcacggcaaccgcacctatgtcatgcagaatgccgacggccaggtgcag
gaaacccattcggtgtcggccgggctggattatcccggcgtggggccggagcatgcatgg
ctcaaggacagcggccgcgccgagtacgcgggcatcaccgacgacgaggcgctggcggcg
ttccacgattgctgccgcatcgagggcatcatgccggcgctggagtccgcgcacgccatt
gcgcaggccgtgaaaatgacgcctgcgctttccaaggacaaggtcatcctggtcaatctg
tccggccggggcgacaaagacatgcacaccgtggccgagcgcgcgggccttcagctctga

DBGET integrated database retrieval system