KEGG   Bordetella pertussis Tohama I: BP3590Help
Entry
BP3590            CDS       T00139                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00260  Glycine, serine and threonine metabolism
bpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpe01100  Metabolic pathways
bpe01110  Biosynthesis of secondary metabolites
bpe01130  Biosynthesis of antibiotics
bpe01230  Biosynthesis of amino acids
Module
bpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BP3590 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BP3590 (trpA)
Enzymes [BR:bpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BP3590 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Peripla_BP_6 PA
Motif
Other DBs
NCBI-GeneID: 2665250
NCBI-ProteinID: NP_882103
UniProt: Q7VTF0
Position
3803955..3804812
Genome map
AA seq 285 aa AA seqDB search
MTTTDRIAAAFARVSEAGRAAALIPYIAAGDPSPQATVPLMHALVRAGADLVELGVPFSD
PMADGPVVQRAAERAIAQGVGLRRVLELVADFRRDDSVTPVVLMGYANPIERMGQRAFAQ
AAQAAGVDGVLVVDYPPEEVDEFAVMLAEAGVAPIFLLAPTSTEARIEAIGRVARGYVYY
VSLKGVTGAGSLDTDDVARKLALIRRHVHIPVGVGFGIRDAASAQRIAAHADAVVIGSKL
IETMEQAGAQAGADQKNEAAIAAAQQWLHTIRLALDDVKRENAPA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgactaccactgaccgaattgccgccgcgtttgcgcgggtttccgaggccggccgcgcg
gcggccctgatcccctacatcgccgccggcgacccgtcgccgcaggcgacggtaccgctg
atgcacgcgctggtgcgcgccggcgccgacctggtcgagctgggcgtgccgttctccgac
cccatggccgacggtccggtggtgcaacgcgccgccgagcgcgccatcgcccagggcgtc
gggctgcgccgcgtgctggagctggtggccgacttccgccgggacgacagcgtcacgccg
gtagtgctgatgggctatgccaatccgatcgaacgcatgggccagcgggcgtttgcgcag
gccgcgcaggcggccggcgtcgacggcgtgctggtggtcgactatccgcccgaagaggtc
gacgagttcgcggtcatgctggccgaagccggcgtggcgccgatcttcctgctggcgccc
acctccaccgaggcccgcatcgaggcgatcggccgcgtggcgcgcggctacgtctattat
gtgtcgctcaagggcgtcacgggcgccggcagcctggatacggacgacgtcgcgcgcaag
ctggcgctgatccgccgccacgtgcacattccggtgggcgtgggcttcggcatccgcgac
gcggccagcgcgcagcgcatcgccgcgcacgccgacgccgtggtcatcggcagcaagctg
atcgagaccatggagcaggccggcgcccaggccggcgcggaccagaaaaacgaggccgcc
atcgcggcggcgcagcaatggctgcacaccatccggctggcgctggatgacgtcaaacga
gaaaacgcgccggcctga

DBGET integrated database retrieval system