KEGG   Bordetella pertussis Tohama I: BP3783Help
Entry
BP3783            CDS       T00139                                 

Gene name
ptxA
Definition
(RefSeq) toxin subunit 1
  KO
K11023  
pertussis toxin subunit 1 [EC:2.4.2.-]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Pertussis
Module
Pertussis pathogenicity signature 1, pertussis toxin
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Human Diseases
  Infectious diseases
   05133 Pertussis
    BP3783 (ptxA)
Enzymes [BR:bpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     BP3783 (ptxA)
Transporters [BR:bpe02000]
 Other Transporters
  Pores ion channels [TC:1]
   BP3783 (ptxA)
Bacterial toxins [BR:bpe02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Pertussis toxin (PT)
    BP3783 (ptxA)
   ADP-ribosyltransferase toxin ArtA/B
    BP3783 (ptxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
3988258..3989067
Genome map
AA seq 269 aa AA seqDB search
MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAW
GNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIG
YIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTR
VYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQA
ESSEAMAAWSERAGEAMVLVYYESIAYSF
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcactcgggcaattcgccaaaccgcaagaacaggctggctgacgtggctggcg
attcttgccgtcacggcgcccgtgacttcgccggcatgggccgacgatcctcccgccacc
gtataccgctatgactcccgcccgccggaggacgttttccagaacggattcacggcgtgg
ggaaacaacgacaatgtgctcgaccatctgaccggacgttcctgccaggtcggcagcagc
aacagcgctttcgtctccaccagcagcagccggcgctataccgaggtctatctcgaacat
cgcatgcaggaagcggtcgaggccgaacgcgccggcaggggcaccggccacttcatcggc
tacatctacgaagtccgcgccgacaacaatttctacggcgccgccagctcgtacttcgaa
tacgtcgacacttatggcgacaatgccggccgtatcctcgccggcgcgctggccacctac
cagagcgaatatctggcacaccggcgcattccgcccgaaaacatccgcagggtaacgcgg
gtctatcacaacggcatcaccggcgagaccacgaccacggagtattccaacgctcgctac
gtcagccagcagactcgcgccaatcccaacccctacacatcgcgaaggtccgtagcgtcg
atcgtcggcacattggtgcgcatggcgccggtgataggcgcttgcatggcgcggcaggcc
gaaagctccgaggccatggcagcctggtccgaacgcgccggcgaggcgatggttctcgtg
tactacgaaagcatcgcgtattcgttctag

DBGET integrated database retrieval system