KEGG   Bordetella pertussis Tohama I: BP3825Help
Entry
BP3825            CDS       T00139                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bpe00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4032293..4033819
Genome map
AA seq 508 aa AA seqDB search
MTANEFILALDQGTTSSRAIVFDRAGTVRGMGQREFRQHYPRPGWVEHDAGEIWQSQLEV
AREALRNAGASAADLAALGITNQRETTLIWERATGRPLARAIVWQDRRTAAMCEKLLHDG
HGRMLQERTGLVVDAYFSGTKLAWLLDHVPGARKMAERGELAFGTMDTWLVWQLTGGAVH
STDPSNASRTMLFDLHAQDWSDDILALLNIPRGILPRIAPSSARIGETLPEWLGGSIPIA
GVAGDQQAATFGQACFTPGMAKNTYGTGCFMLMNVGDAPVASRHNLLSTVGWSLPAGNAT
HATYMVEGGVFMAGAAVQWLRDGLGIIQRSADIEALAASVADTDDVFMVPAFAGLGAPHW
DPYARGTLVGMTRGTTRAHIARATLESIALQSAELLSCMNADSGIPLSELRVDGSAARND
LLMQMQADLLGVPVVRPRVPESTALGAAGLAGLAVGFWSSLDEFGAQWQAERTFEPAWPA
DVREARMQRWRQAVELSKGWSRPAAGHA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcaaatgaattcatcctggcgctggaccagggcacgaccagctcccgcgccatc
gtgttcgaccgcgccggcacagtgcgcggcatggggcagcgcgaattccgccagcactac
ccgcggccgggctgggtcgagcacgatgccggcgaaatctggcaaagccagctcgaggtc
gcgcgcgaggcgctgcgcaacgccggcgccagcgccgccgacctcgccgcgctgggcatc
accaaccagcgcgaaaccaccctgatctgggagcgcgccaccggccgcccgctggcccgc
gccatcgtctggcaggaccgccgcaccgcggcgatgtgcgaaaaactgctgcacgacggc
cacggccggatgctgcaggagcgcaccggcctggtcgtcgacgcgtacttttccggcacc
aagctggcctggctgctcgatcacgtgccgggcgcgcgcaagatggccgagcgcggcgag
ctggccttcggcacgatggacacctggctggtctggcagctgaccggcggcgccgtgcac
agcaccgacccgagcaacgcctcgcgcaccatgctgttcgacctgcacgcccaggactgg
tcggacgatatcctggccctcttgaacattccgcgcggcatattgccgcgcatcgccccc
agcagcgcgcgcatcggcgaaaccctgcccgagtggctgggcggctcgatacccatcgcc
ggcgtggccggcgaccagcaggccgccacgttcgggcaggcctgcttcacgccgggcatg
gccaagaacacctacggcaccggttgcttcatgctgatgaacgtgggcgacgcgccggtg
gcctcgcgccacaacctgctgtccaccgtgggctggagcctgccggcgggcaacgccacg
cacgccacctacatggtggaaggcggcgtgttcatggccggcgcagcggtgcaatggctg
cgcgacggcctgggcatcatccagcgctcggccgacatcgaggccctggcggccagcgtg
gccgacacggacgacgtattcatggtgccggccttcgccggcctgggcgcgccgcactgg
gatccctacgcgcgcggcacgctggtgggcatgacgcgcggcaccacgcgcgcccacatc
gcgcgcgccacgctcgaatcgatcgcgctgcaaagcgccgaactgctgtcgtgcatgaat
gccgacagcggcatcccgctgtccgagctgcgcgtcgacggcagcgcggcgcgcaacgac
ctgctgatgcagatgcaggccgacctgctgggcgtgccggtggtgcgcccgcgcgtgccc
gagtcgaccgcgctgggcgcggccgggctggcgggcctggcggtcgggttctggtcgagc
ctggacgagttcggcgcgcagtggcaggccgaacgcactttcgagccggcctggccggcc
gatgtgcgcgaagcccgcatgcaacgctggcgccaggcggtggagctatcgaagggctgg
tcgcgccctgccgccggccacgcgtga

DBGET integrated database retrieval system