KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110167130Help
Entry
110167130         CDS       T05002                                 

Gene name
abhd12b
Definition
(RefSeq) protein ABHD12B
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110167130 (abhd12b)
Peptidases [BR:bpec01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   110167130 (abhd12b)
Exosome [BR:bpec04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110167130 (abhd12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 331 aa AA seqDB search
MKKVLVFLVSLYVCAPVGVFLFPWILGFAVFGHWNAAPFFVDLTRPELLLNHTVNFYLNP
EPQVSVGVWHSLPSSLWAAAQGRSSLWYEAALGDGRPVVIFLHGNGGTRAAEHRVGLVKK
LTAAGFHVFSLDYRGFGDSSGDPTEAGVTKDALYLYHWVKRRSRGNLICLWGQSLGTGVA
TNAAVRLQNQGSGVDVVVLQAAYTSVRELVALDALAQPYIFLPGFKSLIWTLLEKIEIEF
ANDKNLQTLTSPVLLLHAKDDTTVPFSMAQELFAVSVQTHSRVNRADEVEFVSYSEDLGY
NHRNIYLDPDLPDVVTSFFQKVKRASAAKSM
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtgttggtgtttttggtgtcgctgtacgtctgcgctcctgtcggcgtcttc
ctcttcccctggatcctgggattcgccgtgtttggccactggaacgctgctccattcttc
gtagatctgactcggcccgagctcctcctgaaccacacggtgaacttctacctgaacccg
gagccgcaggtgtcagtgggagtgtggcactcgctcccctccagtctgtgggcggcggct
caggggaggagctcgctgtggtacgaggcggctctgggggacggccgacctgttgtcatc
tttctccacggcaacggaggaaccagagctgcagagcacagagtcggactagtgaagaaa
ctaaccgccgctgggtttcacgtcttttctttagattacagaggcttcggagactcgagc
ggcgacccgactgaagcaggagtgaccaaggacgccctctacctgtaccactgggtaaag
cgccgcagccgagggaacctcatctgcctctggggacaatctctgggcaccggtgtcgcc
acaaacgccgccgtccgcttacaaaatcaaggttctggtgttgacgtcgtggtgcttcaa
gccgcctacaccagcgtccgagagttagtggctttagacgctctggctcagccgtacatt
ttccttcctgggtttaaaagtttgatctggacgcttctggaaaagatcgaaattgaattt
gcaaatgacaaaaatttacaaacgttgacgagtcctgtgctgctgcttcacgccaaagac
gacaccaccgtcccgttttccatggcccaagagttgttcgccgtctcggttcagactcac
tctcgggtaaatcgagcagatgaggtggagtttgtttcttacagtgaagatctcggttat
aatcacagaaacatttatctggacccggatctgcccgacgtcgtcacgagtttcttccag
aaggtgaaacgagcttctgctgcaaagtccatgtga

DBGET integrated database retrieval system