KEGG   Bordetella pertussis 18323: BN118_0036Help
Entry
BN118_0036        CDS       T02296                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bper  Bordetella pertussis 18323
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BN118_0036 (glpK)
Enzymes [BR:bper01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BN118_0036 (glpK)
Exosome [BR:bper04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN118_0036 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(43618..45144)
Genome map
AA seq 508 aa AA seqDB search
MTANEFILALDQGTTSSRAIVFDRAGTVRGMGQREFRQHYPRPGWVEHDAGEIWQSQLEV
AREALRNAGASAADLAALGITNQRETTLIWERATGRPLARAIVWQDRRTAAMCEKLLHDG
HGRMLQERTGLVVDAYFSGTKLAWLLDHVPGARKMAERGELAFGTMDTWLVWQLTGGAVH
STDPSNASRTMLFDLHAQDWSDDILALLNIPRGILPRIAPSSARIGETLPEWLGGSIPIA
GVAGDQQAATFGQACFTPGMAKNTYGTGCFMLMNVGDAPVASRHNLLSTVGWSLPAGNAT
HATYMVEGGVFMAGAAVQWLRDGLGIIQRSADIEALAASVADTDDVFMVPAFAGLGAPHW
DPYARGTLVGMTRGTTRAHIARATLESIALQSAELLSCMNADSGIPLSELRVDGSAARND
LLMQMQADLLGVPVVRPRVPESTALGAAGLAGLAVGFWSSLDEFGAQWQAERTFEPAWPA
DVREARMQRWRQAVELSKGWSRPAAGHA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcaaatgaattcatcctggcgctggaccagggcacgaccagctcccgcgccatc
gtgttcgaccgcgccggcacggtgcgcggcatggggcagcgcgaattccgccagcactac
ccgcggccgggctgggtcgagcacgatgccggcgaaatctggcaaagccagctcgaggtc
gcgcgcgaggcgctgcgcaacgccggcgccagcgccgccgacctcgccgcgctgggcatc
accaaccagcgcgaaaccaccctgatctgggagcgcgccaccggccgcccgctggcccgc
gccatcgtctggcaggaccgccgcaccgcggcgatgtgcgaaaaactgctgcacgacggc
cacggccggatgctgcaggagcgcaccggcctggtcgtcgacgcgtacttttccggcacc
aagctggcctggctgctcgatcacgtgccgggcgcgcgcaagatggccgagcgcggcgag
ctggccttcggcacgatggacacctggctggtctggcagctgaccggcggcgccgtgcac
agcaccgacccgagcaacgcctcgcgcaccatgctgttcgacctgcacgcccaggactgg
tcggacgatatcctggccctcttgaacattccgcgcggcatattgccgcgcatcgccccc
agcagcgcgcgcatcggcgaaaccctgcccgagtggctgggcggctcgatacccatcgcc
ggcgtggccggcgaccagcaggccgccacgttcgggcaggcctgcttcacgccgggcatg
gccaagaacacctacggcaccggttgcttcatgctgatgaacgtgggcgacgcgccggtg
gcctcgcgccacaacctgctgtccaccgtgggctggagcctgccggcgggcaacgccacg
cacgccacctacatggtggaaggcggcgtgttcatggccggcgcagcggtgcaatggctg
cgcgacggcctgggcatcatccagcgctcggccgacatcgaggccctggcggccagcgtg
gccgacacggacgacgtattcatggtgccggccttcgccggcctgggcgcgccgcactgg
gatccctacgcgcgcggcacgctggtgggcatgacgcgcggcaccacgcgcgcccacatc
gcgcgcgccacgctcgaatcgatcgcgctgcaaagcgccgaactgctgtcgtgcatgaat
gccgacagcggcatcccgctgtccgagctgcgcgtcgacggcagcgcggcgcgcaacgac
ctgctgatgcagatgcaggccgacctgctgggcgtgccggtggtgcgcccgcgcgtgccc
gagtcgaccgcgctgggcgcggccgggctggcgggcctggcggtcgggttctggtcgagc
ctggacgagttcggcgcgcagtggcaggccgaacgcactttcgagccggcctggccggcc
gatgtgcgcgaagcccgcatgcaacgctggcgccaggcggtggagctatcgaagggctgg
tcgcgccctgccgccggccacgcgtga

DBGET integrated database retrieval system