KEGG   Bordetella pertussis 18323: BN118_0253Help
Entry
BN118_0253        CDS       T02296                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00071  Fatty acid degradation
bper00280  Valine, leucine and isoleucine degradation
bper00281  Geraniol degradation
bper00310  Lysine degradation
bper00360  Phenylalanine metabolism
bper00362  Benzoate degradation
bper00380  Tryptophan metabolism
bper00410  beta-Alanine metabolism
bper00627  Aminobenzoate degradation
bper00640  Propanoate metabolism
bper00650  Butanoate metabolism
bper00903  Limonene and pinene degradation
bper00930  Caprolactam degradation
bper01100  Metabolic pathways
bper01110  Biosynthesis of secondary metabolites
bper01120  Microbial metabolism in diverse environments
bper01130  Biosynthesis of antibiotics
bper01212  Fatty acid metabolism
Module
bper_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN118_0253
   00650 Butanoate metabolism
    BN118_0253
  Lipid metabolism
   00071 Fatty acid degradation
    BN118_0253
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN118_0253
   00310 Lysine degradation
    BN118_0253
   00360 Phenylalanine metabolism
    BN118_0253
   00380 Tryptophan metabolism
    BN118_0253
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN118_0253
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN118_0253
   00281 Geraniol degradation
    BN118_0253
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN118_0253
   00627 Aminobenzoate degradation
    BN118_0253
   00930 Caprolactam degradation
    BN118_0253
Enzymes [BR:bper01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN118_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCJ61678
UniProt: A0A0U1RMT9
Position
265001..265735
Genome map
AA seq 244 aa AA seqDB search
MEVTYQSLDGIALITINRPQRGNSMNPAVVRELARAWERFSDGDELVAVITGAGDDAFCT
GADLKELPGEVWRALPNFAVPTDKPIIAAVSGHAVGGGCTLALYVDMIVASESAKFVYPE
AKLGIFQGIMGGFPRKLPYAAGLEWITTGDPMSAQRAYELGFVNKVCKVGEQVEVALEMA
RKIAGSAPLVVQAMKHLALKTLPANPMETFYPQKRMLEAIARSQDAEEGLQALRDKRAPV
FKGC
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcacttaccagtcgctcgacgggattgcgctgatcacgatcaacaggccgcag
cgggggaattcgatgaacccggcggtggtccgggaactggcccgggcctgggagcgattc
tccgacggggatgagctggtcgcggtgatcacgggcgcgggcgacgatgcgttctgcacc
ggggcggacctcaaggagttgccgggcgaggtatggcgcgcgctgcccaacttcgccgtg
cccaccgacaagcccatcatcgccgcggtcagcggccatgccgtgggaggaggctgcacc
ctggcgctctacgtggacatgatcgtcgccagcgagtcggcgaagttcgtctatccggag
gcgaagctgggcatcttccagggaatcatggggggctttcccagaaagctgccttacgcg
gccggattggagtggatcacgaccggcgaccccatgtccgcgcagcgcgcatacgaactg
ggtttcgtgaacaaggtgtgcaaggtgggcgagcaggtcgaggtggcgctggagatggcg
cgcaagatcgccggcagcgcgccgctggtcgtgcaggccatgaagcacctggcgctcaag
accttgccggccaaccccatggaaaccttctatccgcaaaagcgcatgctcgaggcgatc
gccaggagccaggatgccgaggagggtctccaggcgctgcgcgacaagcgcgctccggta
ttcaagggctgctag

DBGET integrated database retrieval system