KEGG   Bordetella pertussis 18323: BN118_0326Help
Entry
BN118_0326        CDS       T02296                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00240  Pyrimidine metabolism
bper00250  Alanine, aspartate and glutamate metabolism
bper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BN118_0326 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN118_0326 (pyrB)
Enzymes [BR:bper01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BN118_0326 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CCJ61751
UniProt: A0A0U1RMW1
Position
complement(334365..335318)
Genome map
AA seq 317 aa AA seqDB search
MLNPQLNRHGELIHLLSTEGLPRRIIEQILDLAATFVPAPGQEFPKLPLLHGKSVFNLFF
ENSTRTRTTFEIAAKRLSADVVNLNIAASSTSKGESLLDTIANLSAMQADLFVVRHGASG
APYLIAQHVAPHVHVINAGDGRHAHPTQALLDMYTIRHHKGDFNQLTVAIVGDVLHSRVA
RSDIHALTTLGVPEVRVVAPATLLPEGLAQMGVRVCTDMEEGLRDADVVIMLRLQNERMR
GALLPSAHEYFKHYGLTQARLALARPDAIVMHPGPMNRGVEIASEVADSGQAVILDQVTF
GIAVRMAAMSLVAGVRP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatccccaactcaatcgccacggcgagctgatccacctgctgtccaccgaaggc
ctgccgcgccgcatcatcgagcagatcctcgacctggccgccaccttcgtgccggcgccc
ggacaggaattccccaagctgcccctgctgcacggcaaaagcgtgttcaacctgttcttc
gagaactccacccgcacgcgcaccaccttcgagatcgccgccaagcgcctgtcggccgac
gtggtcaacctgaacatcgccgcctcgtccacgtccaagggcgaatccctgctcgatacc
atcgccaacctgtcggccatgcaggccgacctgttcgtggtgcgccacggcgccagcggc
gcgccgtatctgatcgcgcagcacgtggcgccccatgtccatgtcatcaacgccggcgac
ggccgccatgcgcatcccacgcaggccttgctggacatgtacaccatccgtcaccacaag
ggcgatttcaaccagctgacggtggccatcgtcggcgacgtactgcattcgcgcgtggcg
cgctccgacatccacgccctgaccacgctgggcgtgcccgaagtgcgcgtggtggcgccg
gccacgctgctgcccgaggggctggcgcagatgggcgtgcgcgtctgtaccgacatggaa
gaagggctgcgcgacgccgacgtcgtcatcatgctgcgcctgcagaacgaacgcatgcgc
ggcgcgctgctgccgtcggcgcacgaatacttcaagcactatggcctgacgcaggcccgc
ctggcgctggcccggcctgacgccatcgtgatgcacccggggccgatgaaccgcggcgtc
gagatcgcctccgaggtggccgacagcggccaggccgtgatactggaccaggtgacattc
ggcatcgcggtgcgcatggccgccatgagcctggtcgcgggagtacggccatga

DBGET integrated database retrieval system