KEGG   Bordetella pertussis 18323: BN118_0494Help
Entry
BN118_0494        CDS       T02296                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bper  Bordetella pertussis 18323
Brite
Enzymes [BR:bper01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BN118_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
527643..528323
Genome map
AA seq 226 aa AA seqDB search
MNASTLPDVEQARFNMVEQQIRPWDVLDPKVLDALFAVRRELFVPPALRALAFSDLEIPL
EINAVNTRQNMLAPKIEARLAQELLLQPTDCVLEIGTGSGYQAALLAYLAQQVTTVEIDS
RLATFAQQNLQVNNVADVKVETGDGRNGWGSTEYDAILVTGSVPVVPDALKYQLRVGGRL
VVIVGQAPIMTAYRITRTTAASFETVSLFETVIKPLRGTTVSQFKF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttcgaccctgcccgacgtagaacaagcccgattcaacatggtggaacagcaa
atccgcccctgggacgtgctggaccccaaggtgctggacgccctgttcgccgtacgccgg
gaattgttcgtgccgccggcgctacgcgccctggccttctccgacctcgaaatcccgctt
gaaatcaacgcggtcaacacgcgccagaacatgctggcccccaagatcgaggcgcgcctg
gcccaggaactgctgctgcagccgaccgactgtgtgctggagatcggcaccggctcgggc
taccaggccgccctgctggcctacctggcgcaacaggtgaccacggtcgaaatcgacagc
cgcctggccaccttcgcccagcagaacctgcaggtgaacaatgtggccgacgtcaaggtc
gaaacgggcgacggccgcaatggctggggctcgaccgaatacgacgcgatcctggtcacc
ggttcggtgccggtggtgcccgacgcgctgaaataccagttgcgcgtgggcggccggctg
gtcgtcatcgtcggacaggcgcccatcatgaccgcctaccgcatcacgcgcaccacggcc
gccagcttcgagaccgtctcgctgttcgagaccgtcatcaagccgctgcgcggcaccacc
gtatcccagttcaaattctga

DBGET integrated database retrieval system