KEGG   Bordetella pertussis 18323: BN118_0572Help
Entry
BN118_0572        CDS       T02296                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bper  Bordetella pertussis 18323
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bper00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(611944..612435)
Genome map
AA seq 163 aa AA seqDB search
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFV
NAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPH
PRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagcccggcttccaccctggcatacgtcggcctgggagccagcctgggcgac
gcggccgccacgctgcgcagcgtgcttgccgaactggccgccgcgccaggcatcctcgcc
tgcaaggcttcgcgcctgtaccggacggcgcccgtcgaggcccagggtcccgacttcgtc
aacgcggtcgccgcgctcgacaccacgctggcgccgctggacctgctggacctgttgcag
gcgctggaacagcgccatggccgcgagcggccctaccgcaatgcgccgcgcaccctggac
ctggacctgctgctgtatggcgaacaggccatcgaccatccccgcctgagcgtgccgcat
ccgcgcatgcatgaacgcgccttcgtgctggcgccgctgtgcgaactggtccccgccctg
cgcctggcgcaaggcgactgcgcggcgctgctggccgcgctggaagaccaggccatcgag
ccgctgcgctga

DBGET integrated database retrieval system