KEGG   Bordetella pertussis 18323: BN118_0645Help
Entry
BN118_0645        CDS       T02296                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bper  Bordetella pertussis 18323
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN118_0645 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN118_0645 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN118_0645 (thrC)
Enzymes [BR:bper01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN118_0645 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
683703..685109
Genome map
AA seq 468 aa AA seqDB search
MKYISTRGGMAPQSFSDILLEGLAPDGGLAIPEQLPQVDAATLESWRGLSYADLAFEVLS
LFATDIPAEDLRGLTRAAYRQGVFKSEDIVPVRELGQGLQLLGLSEGPTLAFKDMAMQFL
GQVFEYVLTRRGTTLNIVGATSGDTGSAAEYALRGKQGVAVFMLSPHGRMSAFQRAQMYS
LQDENIHNIAVRGVFDQAQDIVKQLAGDLAFKTRYRLGAVNSINWARIAAQVVYYFHGWL
RAAPKGGEVSFAVPSGNFGNILSGHIARGMGVPIRRLVLATNENNVLEEFFRTGGYRPRG
PEHTYATSSPSMDISRASNFERFVFDLVGRDPGRVASLWADLARDGSFDLSALKPQFETR
YGFVAGASSHADRLQTIRNTFDETGVLVDPHTADGIKVARQFVEPGVPMLVLETALPAKF
AETIEAALGRTVPPPADLADLESLPQRVTLMDCDAQAVRAFIEAHAKV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatctcgacccgcggcggcatggccccgcagagtttctccgacatcctgctc
gaaggcctggcgcccgacggcgggctggccatccccgagcagctgccgcaagtcgacgcg
gccacactggagtcctggcgcgggctctcgtacgccgacctggccttcgaagtgctgtcg
ctgttcgccaccgacatcccggccgaggacctgcgcgggctgacgcgcgcagcctaccgg
cagggcgtgttcaagagcgaagacatcgtcccggtgcgcgagctggggcaggggttgcag
ctgctgggcctgtccgaggggcccacgctggccttcaaggacatggcgatgcagtttctc
ggccaggtcttcgagtacgtcctgacgcggcgcggcaccacgctgaacatcgtcggcgcc
acctccggcgataccgggtcggcggccgagtacgcgctgcgcggcaagcagggcgtggcc
gtgttcatgctgtcgccgcacggccgcatgagcgcattccagcgcgcccagatgtactcg
ctgcaggatgagaacattcacaatatcgcggtgcggggcgtgttcgaccaggcgcaggac
atcgtcaagcagctggccggcgacctggcgttcaagacgcgctatcgcctgggcgcggtc
aactcgatcaactgggcgcgcatcgccgcccaggtggtgtactacttccacggctggctg
cgtgccgcgcccaagggtggcgaggtgtcgttcgcggtgccttcgggcaacttcggcaac
atcctgtccgggcacatcgcgcgcggcatgggcgtgccgatccgccgcctggtgctggcc
accaacgagaacaacgttctcgaggagttcttccgcaccggcggttaccgcccgcgcggt
cccgagcacacctacgccacctccagcccgtcgatggacatctcgcgcgcctcgaacttc
gagcgcttcgtgttcgacctggtcgggcgcgaccccggccgcgtggcgtcgctgtgggcc
gacctggcgcgcgacggcagcttcgacctgtcggcgctcaagccgcagttcgaaacccgc
tacgggttcgtggccggcgccagctcgcacgccgaccgcctgcagaccatacgcaatacc
ttcgacgaaaccggcgtgctggtcgacccgcacacggccgatggcatcaaggtggcgcgc
cagttcgtcgagccgggcgtgcccatgctggtgctcgagacggccctgccggccaagttc
gcggaaaccatcgaggcggcgctcgggcgcaccgtgccgccgccggctgacctggccgac
ctcgaatcgctgccccagcgcgtgacgctcatggactgcgacgcgcaggcggtgcgggcc
ttcatcgaggcccacgccaaagtgtaa

DBGET integrated database retrieval system