KEGG   Bordetella pertussis 18323: BN118_1018Help
Entry
BN118_1018        CDS       T02296                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bper  Bordetella pertussis 18323
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bper00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bper02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109059..1109469
Genome map
AA seq 136 aa AA seqDB search
MNAGLAWRAGALCLALAAPSAARAAAPDPVRGEQVYARCLACHALAYDRVGPRHCGLLGR
KAGSVPGFAYTQAMKDSGLTWDAATLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYL
RAAAASPACAGVATPH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgggcctggcctggcgggccggcgcgctgtgcctggccctggccgcgccgtcg
gccgcgcgggccgcggcgcccgacccggtgcgcggcgagcaggtctacgcgcgctgcctg
gcctgccacgcgctggcctacgaccgggtggggccgcgccactgcggcctgctcgggcgc
aaggccggcagcgtgcccggtttcgcctatacgcaagccatgaaggactccggcctgacc
tgggacgccgccacgctcgaccgcttcctggccgatcccttgaagaccgtgccaggcacc
gccatgacctacgcgggcgtgccggatgcgggcgagcgcgccgacctcatcgcctacttg
cgcgcggccgccgcctcgccggcgtgcgcgggcgtggccacgccgcattag

DBGET integrated database retrieval system