KEGG   Bordetella pertussis 18323: BN118_1446Help
Entry
BN118_1446        CDS       T02296                                 

Gene name
cheB
Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bper  Bordetella pertussis 18323
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bper00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN118_1446 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BN118_1446 (cheB)
Enzymes [BR:bper01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BN118_1446 (cheB)
Two-component system [BR:bper02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BN118_1446 (cheB)
Bacterial motility proteins [BR:bper02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BN118_1446 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1577364..1578416
Genome map
AA seq 350 aa AA seqDB search
MKKIKVLCVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELIKKHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLIEYS
EVIADKIRAASRARLRALAPASHAAPLRLRSPFASSEKLVIVGASTGGTEAIREVLQPLP
ADSPAILITQHMLAGFTRSFAQRLDALCAVTVREASDGERVLPGHVYLAPGGETHMRLGR
SGANYVIGLQASEPVNRHRPSVDVLFHSAAEAAGGNAIGVILTGMGKDGAAGLLAMKRAG
ARTMAQDEASCVVFGMPREAIALGAADEVVPLADISERILTRLGDRGHRV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatcaaggtcttgtgcgtggatgattccgcgctggtgcgcggtctgatgacc
gagatcatcaacagccatccggacatggaggtggtcgcgaccgcgcccgatccgctggtg
gcgcgcgaactgatcaagaagcacaacccggacgtgctgacgctggatgtggaaatgccg
cgcatggacggcctggatttcctcgaaaagctgatgcggctgcggcccatgccggtggtg
atggtgtcgtcgctgaccgagcgcggcggcgagatcacgctgcgggcgctggaactgggc
gcgatcgatttcgtgaccaagcccaagctggggatccgcgacgggttgatcgagtattcc
gaggtgatcgcggacaagatccgcgccgcctcgcgcgcgcgcctgcgcgcgctggcgccg
gcgagccacgcggcgccgctgcgcctgcgcagtccgttcgccagctccgagaagctggtg
atcgtgggcgcatcgaccggcggcaccgaagcgatccgcgaggtgctgcagcccctgccg
gccgacagcccggcgatcctcatcacccagcacatgctggccggcttcacgcgctcgttc
gcgcagcgcctggacgcgctgtgcgcggtgaccgtgcgcgaagccagcgacggcgagcgg
gtgctgcctggccacgtgtacctggcgccgggcggcgagacgcatatgcgcctgggccgc
agcggcgccaactacgtgatcgggctgcaggccagcgagccggtcaaccggcaccgcccc
tcggtggacgtgctgttccattcggccgccgaggcggccggcggcaatgcgatcggggtg
atactgaccggcatgggtaaggatggcgcggccggcttgctggccatgaaacgcgccggc
gcacggaccatggcgcaggacgaggccagttgcgtggtcttcggcatgccgcgcgaggcc
atcgcgctgggcgcggccgacgaggtcgtgccgctggccgacatcagtgagcggattctg
acgcgtctgggcgaccgcgggcatcgcgtttga

DBGET integrated database retrieval system