KEGG   Bordetella pertussis 18323: BN118_1758Help
Entry
BN118_1758        CDS       T02296                                 

Definition
(RefSeq) glutathione S-transferase (EC:2.5.1.18)
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bper  Bordetella pertussis 18323
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN118_1758
Enzymes [BR:bper01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN118_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1925249..1925950
Genome map
AA seq 233 aa AA seqDB search
MIDLYYWTTPNGHKITLFLEETGLPYRIHPVNISKGEQFQPEFLAIAPNNRIPAIVDQAP
ADGGTPIPLFESGAILLYLAEKTGQFIPADLRGRADVLQWLFWQMGGLGPMAGQNHHFSA
YAPERIPYAIERYVKETNRLYGVLDRQLAQREFVAGDYSIADMAAYPWIVPHERQGQDLN
EFPNLKRWFEAIGARPATQRAYALADRINTKPSVDTEESRRVLFGQTAANVRR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctctactactggacgactcccaacggccacaagatcacgctctttctcgaa
gagaccggcctgccttaccgcatacaccccgtcaacatcagcaagggcgagcagttccag
ccggaattcctggccatcgcgcccaacaaccgcatcccggccatcgtcgatcaggcgccg
gccgatggcggcacgccgatcccgctgttcgagtccggcgccatcctgctgtacctggcc
gagaagaccggccaattcatccccgccgacctgcgcgggcgcgccgacgtgctgcagtgg
ctgttctggcagatgggcggactgggccccatggccggccagaaccaccacttctcggcc
tatgcgcccgagcgcatcccctacgccatcgagcgctacgtcaaggaaaccaaccgcctg
tatggcgtgctcgaccgccagctggcgcagcgcgagttcgtcgccggcgactactcgatc
gccgacatggcggcctatccctggatcgtgccgcacgagcgccagggccaggacctgaac
gagtttccgaacctcaagcgctggttcgaggccatcggcgcccgcccggccacgcagcgc
gcctacgcgctggccgaccggatcaacaccaagccgtcggtcgacaccgaggagtcccgc
cgcgtgctgttcggccagaccgccgccaacgtgcgccgctga

DBGET integrated database retrieval system