KEGG   Bordetella pertussis 18323: BN118_1758Help
Entry
BN118_1758        CDS       T02296                                 

Definition
(GenBank) Glutathione S-transferase (EC 2.5.1.18)
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bper  Bordetella pertussis 18323
Brite
Enzymes [BR:bper01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BN118_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1925249..1925950
Genome map
AA seq 233 aa AA seqDB search
MIDLYYWTTPNGHKITLFLEETGLPYRIHPVNISKGEQFQPEFLAIAPNNRIPAIVDQAP
ADGGTPIPLFESGAILLYLAEKTGQFIPADLRGRADVLQWLFWQMGGLGPMAGQNHHFSA
YAPERIPYAIERYVKETNRLYGVLDRQLAQREFVAGDYSIADMAAYPWIVPHERQGQDLN
EFPNLKRWFEAIGARPATQRAYALADRINTKPSVDTEESRRVLFGQTAANVRR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctctactactggacgactcccaacggccacaagatcacgctctttctcgaa
gagaccggcctgccttaccgcatacaccccgtcaacatcagcaagggcgagcagttccag
ccggaattcctggccatcgcgcccaacaaccgcatcccggccatcgtcgatcaggcgccg
gccgatggcggcacgccgatcccgctgttcgagtccggcgccatcctgctgtacctggcc
gagaagaccggccaattcatccccgccgacctgcgcgggcgcgccgacgtgctgcagtgg
ctgttctggcagatgggcggactgggccccatggccggccagaaccaccacttctcggcc
tatgcgcccgagcgcatcccctacgccatcgagcgctacgtcaaggaaaccaaccgcctg
tatggcgtgctcgaccgccagctggcgcagcgcgagttcgtcgccggcgactactcgatc
gccgacatggcggcctatccctggatcgtgccgcacgagcgccagggccaggacctgaac
gagtttccgaacctcaagcgctggttcgaggccatcggcgcccgcccggccacgcagcgc
gcctacgcgctggccgaccggatcaacaccaagccgtcggtcgacaccgaggagtcccgc
cgcgtgctgttcggccagaccgccgccaacgtgcgccgctga

DBGET integrated database retrieval system