KEGG   Bordetella pertussis 18323: BN118_1758Help
Entry
BN118_1758        CDS       T02296                                 

Definition
glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bper  Bordetella pertussis 18323
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bper00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1925249..1925950
Genome map
AA seq 233 aa AA seqDB search
MIDLYYWTTPNGHKITLFLEETGLPYRIHPVNISKGEQFQPEFLAIAPNNRIPAIVDQAP
ADGGTPIPLFESGAILLYLAEKTGQFIPADLRGRADVLQWLFWQMGGLGPMAGQNHHFSA
YAPERIPYAIERYVKETNRLYGVLDRQLAQREFVAGDYSIADMAAYPWIVPHERQGQDLN
EFPNLKRWFEAIGARPATQRAYALADRINTKPSVDTEESRRVLFGQTAANVRR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctctactactggacgactcccaacggccacaagatcacgctctttctcgaa
gagaccggcctgccttaccgcatacaccccgtcaacatcagcaagggcgagcagttccag
ccggaattcctggccatcgcgcccaacaaccgcatcccggccatcgtcgatcaggcgccg
gccgatggcggcacgccgatcccgctgttcgagtccggcgccatcctgctgtacctggcc
gagaagaccggccaattcatccccgccgacctgcgcgggcgcgccgacgtgctgcagtgg
ctgttctggcagatgggcggactgggccccatggccggccagaaccaccacttctcggcc
tatgcgcccgagcgcatcccctacgccatcgagcgctacgtcaaggaaaccaaccgcctg
tatggcgtgctcgaccgccagctggcgcagcgcgagttcgtcgccggcgactactcgatc
gccgacatggcggcctatccctggatcgtgccgcacgagcgccagggccaggacctgaac
gagtttccgaacctcaagcgctggttcgaggccatcggcgcccgcccggccacgcagcgc
gcctacgcgctggccgaccggatcaacaccaagccgtcggtcgacaccgaggagtcccgc
cgcgtgctgttcggccagaccgccgccaacgtgcgccgctga

DBGET integrated database retrieval system