KEGG   Bordetella pertussis 18323: BN118_2044Help
Entry
BN118_2044        CDS       T02296                                 

Gene name
aceA
Definition
(GenBank) putative isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00630  Glyoxylate and dicarboxylate metabolism
bper01100  Metabolic pathways
bper01110  Biosynthesis of secondary metabolites
bper01120  Microbial metabolism in diverse environments
bper01200  Carbon metabolism
Module
bper_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BN118_2044 (aceA)
Enzymes [BR:bper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BN118_2044 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: CCJ63469
UniProt: A0A0T7CPM3
Position
complement(2226577..2227899)
Genome map
AA seq 440 aa AA seqDB search
MSNRETEIRNLQKDWAENTRWQGIKRAYSAEDVIRLRGSVAVEHSLARRGATRLWDSLHS
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVR
RINNALARCDQIQWMEGKNPGDQDYIDYYAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTREAVSKLVSARLVADVMGTPTILLARTDADAADLVT
SDVDENDRPFITGERTVEGFFRTRAGLDQAISRGLAYAPYADLIWCETSTPNLEYARKFA
EAVHRQFPGKLLAYNCSPSFNWKKNLDDGTIAKFQRELGAMGYKFQFITLAGFHALNYGM
FELAHGYARRQMSAFVELQQKEFAAAELGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTA
LTGSTEEVQFEQGGQAVKAA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgcgaaaccgaaatccgcaacttgcagaaagactgggccgagaacacccgc
tggcagggcatcaagcgcgcctacagcgccgaggatgtgatccgcctgcgcggctcggtg
gccgtcgagcattcgctggcgcgccgcggcgcgacccgcttgtgggattcgttgcatagc
gagcccttcgtcaattcgctgggcgcgttgaccggcaaccaggccatgcagcaggtcaag
gccggcctgaaggccatctacctgtccggctggcaggtggccggcgacgccaacctggcc
ggcgagatgtacccggaccagtcgctgtaccccgccaactcggtgccgcaggtggtgcgc
cggatcaacaacgccctggcgcgttgcgaccagatccagtggatggaaggcaagaacccg
ggcgaccaggattacatcgattactacgcgcccatcgtggccgatgccgaggccggtttc
ggcggcgtgctcaacgccttcgaactgatgaaggccatgatcgaggcgggcgcggctggc
gtgcacttcgaagaccagctggcttcggtgaagaagtgcggccacatgggcggcaaggtg
ctggtgccgacccgcgaggctgtgtccaagctggtctcggcccgcctggtcgccgacgtg
atgggcacgcccaccatcctgctggcccgcaccgacgccgacgcggccgacctggtgacc
agcgacgtggatgagaacgatcgcccgttcatcaccggcgagcgcacggtggaaggcttc
ttccgcacccgcgccggcctggaccaggcgatttcgcgcggcctggcctacgcgccgtat
gccgacctgatctggtgcgaaacctccacgcccaacctggagtatgcgcgcaagttcgcc
gaggccgtccatcgccagttcccgggcaagctgctggcgtacaactgctcgccctcgttc
aactggaagaagaacctggacgacggcacgatcgccaagttccagcgcgaactcggtgcg
atgggctacaagttccagttcatcacgctggccggcttccacgcgctgaactacggcatg
ttcgaattggcgcacggctatgcgcgccgccagatgagcgctttcgtggaattgcagcag
aaggagttcgccgccgccgaactgggctttaccgcggtcaagcaccagcgcgaagtcggc
accggctacttcgacgccgtgacccagaccatcgaaggcggccaatcctcgaccacggcc
ctgaccggctcgaccgaggaagtgcagttcgagcagggcgggcaggccgtcaaggcggcg
tga

DBGET integrated database retrieval system