KEGG   Bordetella pertussis 18323: BN118_2049Help
Entry
BN118_2049        CDS       T02296                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bper  Bordetella pertussis 18323
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bper00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bper00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2232868..2233926)
Genome map
AA seq 352 aa AA seqDB search
MSSKKKTKPVLPPGPVMVDVAGTTLTKDEKRRLRNPLVGGVILFARNFTDRRQLCALTRA
IHKARKEPLLIAVDHEGGRVQRFRDDGFTALPPMQELGKLWDRDPLAAMRLATEAGYVLA
AELRACGVDLSFTPVLDLDYGVSKVIGNRAFHHDARVVTMLSRALTQGLALAGMAACGKH
FPGHGFVGADSHHEIPVDPRPLARILKDDAAPYAWLGDLVMPAVMPAHVIYPKVDAQPAG
FSRRWVSEILRERLGYDGVVFSDDLTMEGASVAGDILARAEAALGAGCDMVLVCRPDLAD
ELLDRLQVQHPAASVERIRRLLPRFAAPDWDTLQNDSRYQHARRLQSQIVSG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaagaagaaaaccaagcccgtcctgcctcccggtcccgtcatggtggatgtg
gccggcacgacgctgaccaaggacgagaagcgccgcctgcgcaaccccctggtgggcggg
gtgatcctgttcgcgcgcaatttcaccgatcgccggcaattgtgcgcgctgacgcgggcc
atccacaaggcgcgcaaggagccgctgctgatcgcggtggaccacgagggcggccgcgtg
cagcgctttcgcgacgatggctttaccgcgttgccgcccatgcaggaactgggcaagctg
tgggaccgcgatccgctggcggcgatgcggctggcgaccgaggccggctacgtgctggcc
gccgagctgcgcgcctgcggcgtcgatctcagcttcacgccggtattggacctcgactac
ggcgtgagcaaggtgatcggcaatcgcgccttccaccatgacgcacgcgtggtcaccatg
ctgtcgcgcgcgctgacgcagggcctggcgctggcgggcatggcggcctgcggcaagcat
ttccccggccatgggttcgtgggcgccgattcgcaccacgagatcccggtcgatccgcgg
ccgctcgcgcgcatcctgaaggatgacgcggcgccttacgcctggctgggcgacctggtc
atgccggctgtcatgccggcgcatgtgatctatccgaaggtcgatgcccagcccgcgggt
ttttcgcgccgctgggtcagcgagatcctgcgtgaacggctgggctacgatggcgtggtg
ttctccgacgatctgaccatggagggcgcgtcggtggcgggcgacatcctggcccgcgcc
gaggcggccctgggcgccggctgcgacatggtgctggtatgccgcccggacctggccgac
gagctgctggaccgcctgcaggtccagcatccggccgcctcggtcgagcgcatccgccgg
ctgttgccgcggttcgccgcgccggactgggacactttgcagaatgacagccgctatcag
catgcccgacgacttcaatctcaaatcgtttctggctga

DBGET integrated database retrieval system