KEGG   Bordetella pertussis 18323: BN118_2140Help
Entry
BN118_2140        CDS       T02296                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bper  Bordetella pertussis 18323
Brite
Enzymes [BR:bper01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BN118_2140 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_18 Methyltransf_24 TrmK Methyltransf_11 Methyltransf_23 Methyltransf_32 SAM_MT MTS
Motif
Other DBs
NCBI-ProteinID: CCJ63565
UniProt: A0A0T7CPK4
Position
complement(2329843..2330481)
Genome map
AA seq 212 aa AA seqDB search
MNSDRLRQAMVQRLRAQGIADERVLNAMAAVPRHLFVDEALASRAYEDAALPIGHSQTIS
QPWVVARMIAAVCEDRAPARVLEVGAGCGYQAAVLAQIVREVHAIERIRGLYELARGHLR
ALRLATRVRLIHGDGMLGVPGVAPFDAIVVAAAGLAIPQALLDQLAPGGRLIAPEGSTHQ
RLVLIERTGATAWSRKELEAVRFVPLRAGIQS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ctgaactccgaccggctgcgccaggcgatggtgcagcggttgcgcgcgcagggcatcgcc
gacgaacgggtgctcaacgccatggcggcggtgccgcgccatctgttcgtcgacgaagcg
ctggccagccgtgcctacgaagacgcggcgctgcccatcgggcactcgcagaccatttcg
cagccgtgggtggtggcccgcatgatcgccgctgtctgcgaggaccgtgctccggcgcgg
gtgctcgaggttggcgccggctgcggctaccaggcggcggtactggcccagatcgtgcgc
gaggtgcatgccatcgagcgtatccgcggcctgtacgagctggcgcgcggccatctgcgg
gcgctgcgcctggccacccgggtgcgcctgatccatggcgacggcatgctgggcgtgccc
ggcgtggcgccgttcgatgctattgttgtggctgcggcgggcctggccattccgcaggcc
ttgctggatcagcttgcgccgggcgggcggctgatcgcgcccgaagggtccacccaccag
cggctggtgctgatcgaacgcaccggggccaccgcgtggagccgaaaagaactcgaagct
gtacgttttgtgcccctcagggccggaatacaatcttga

DBGET integrated database retrieval system