KEGG   Bordetella pertussis 18323: BN118_2474Help
Entry
BN118_2474        CDS       T02296                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bper  Bordetella pertussis 18323
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN118_2474
Enzymes [BR:bper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BN118_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2698226..2699026)
Genome map
AA seq 266 aa AA seqDB search
MESMMSSSYTVQDKDVLRARVDREIESRVSEPQWTRAQKMALACRMLAEQGHWHGGLAGQ
ITERGDEPGTYWTLPFGVGADEARASELILIDEDLNPLDGKSLPNPANRFHIWIYRHRPN
VQCIVHTHPPAVSALSMVGEPLVVAHMDATPFYNDCAYLPQWPGLPIGDNEGEVISAALG
EKRAILLANHGLLTAGSSIEESAVMALWMEQAAMLQLRARAIGPVKAVPGELAQESHDFL
VKPKIQSLTFAYFARRVLRAAPDCLD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcatgatgtcgtcttcttacacagtgcaggacaaggatgtattgcgcgcgcgc
gtcgaccgcgaaatcgagtcgcgcgtgagcgagccgcaatggacgcgcgcccagaaaatg
gcgctggcctgccgcatgctggccgagcagggccactggcatggcgggctggccggccag
atcacggagcgcggcgacgagccgggcacgtactggacgctgccgttcggcgtgggcgcc
gacgaggcgcgcgccagcgaactgatcctgatcgacgaggacctcaatccgctcgacggc
aaatcgctgcccaatcccgccaatcgcttccacatctggatttaccggcaccggcccaac
gtgcagtgcatcgtccatacccatccgccggccgtctcggcgctgtcgatggtgggcgag
ccgctggtggtggcgcatatggacgccacgccgttctacaacgattgcgcctatctgccg
caatggccgggcctgcccatcggcgacaacgagggcgaggtgatttcggccgcgctgggc
gagaagcgcgccatcctgctggccaaccatggcctgttgaccgccggcagttcgatcgag
gaatccgccgtcatggcgctgtggatggagcaggcggcgatgctgcaattgcgcgcgcgc
gccatcgggccggtcaaggcggtgccgggcgaactggcgcaggaatcgcacgacttcctg
gtcaagcccaagatccagtcgctgacctttgcctatttcgcgcggcgcgtgctgcgggcc
gcgcccgactgcctggattga

DBGET integrated database retrieval system