KEGG   Bordetella pertussis 18323: BN118_2629Help
Entry
BN118_2629        CDS       T02296                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bper  Bordetella pertussis 18323
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bper00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bper00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bper03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bper03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bper03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2867323..2867778
Genome map
AA seq 151 aa AA seqDB search
MTRIDFAFGAPDRLRAACRTARKRFQAGQRLVVYCADGGRLAAFDRMLWALEDVSFVPHV
LANDALAADTPVLLTAGDPAAALALATTGDSRPWLLNLDDGCPPNFDGYERLLEIVSDDP
ADRQAARQRWRDYQNAGHALHSHDLSRAGEA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcatcgacttcgccttcggcgctccggaccgcctgcgcgcggcctgccgcacc
gcgcgcaagcgcttccaggcgggccagcggctggtggtctactgcgccgacggcggacgc
ctggccgccttcgaccggatgctgtgggccctggaggacgtctcgttcgtgccgcatgtg
ctggccaacgacgcgctggcggccgacacgccggtcctgctgaccgcgggcgaccccgcc
gccgccctggcgctggccaccaccggcgacagccgcccctggctgctgaacctggatgac
ggctgcccgcccaacttcgatggctacgagcgcctgctggaaatcgtctccgacgacccg
gccgaccgccaggcggcgcgccagcgctggcgcgactatcagaatgccggccatgcgctg
cacagccatgacctgagccgcgcgggcgaggcctga

DBGET integrated database retrieval system