KEGG   Bordetella pertussis 18323: BN118_2634Help
Entry
BN118_2634        CDS       T02296                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00260  Glycine, serine and threonine metabolism
bper00750  Vitamin B6 metabolism
bper01100  Metabolic pathways
bper01110  Biosynthesis of secondary metabolites
bper01120  Microbial metabolism in diverse environments
bper01230  Biosynthesis of amino acids
Module
bper_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN118_2634
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN118_2634
Enzymes [BR:bper01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN118_2634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCJ64059
UniProt: A0A0T7CR20
Position
2871049..2872245
Genome map
AA seq 398 aa AA seqDB search
MLMNPSLSRLRCLRCSHAVPPGDYPEGCPRCLAAGYPASLACEYEPADTQPMPLPVLAPI
TLGEDRTPCLDEPSLAHAHGVAQVWLKCESGNPTGSHKDRMAAQLVSRAVLAGAKRLAAA
SSGNAGVALAAYGAAAGLRVDIAIAPTCPPRQRAAMEHFGARLHSFADSLACWPYVATLC
RDEGAFAGTNYLNPPVGTHPYGVEGYKPIAAELAAQCDNLPTDIIVPTARGDLLWGICLG
WQALLRRGAIARLPRLHAVEPYPRLAHALAAGDARGVWEQPTAQYSIAGGTATLQSMQAL
VRSGGQAVDVADEQAVDVADEQAVDVADEQAVDVADEQAVDVADEQAARARAALGALGIA
AELSSAAALAAVPALKAAGALDAGSRVALILTSDGRRD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgaacccctcgctgtcccgcctgcgctgcctgcgctgttcccacgccgtgccg
ccgggcgactatccggaaggctgcccgcgctgcctggcggccggctacccggcctcgctg
gcatgcgaatacgaaccggccgatacgcagccgatgccgctgccggtcctcgcgccgatc
acgctgggcgaagaccgcacgccctgcctcgacgagccgtcgctggcgcatgcgcacggg
gtggcgcaagtctggctgaaatgcgaaagcggcaacccgacgggcagccacaaggaccgc
atggctgcgcaactggtgtcgcgcgcggtgctggccggcgccaagcggctggcggccgcg
tccagcggcaacgccggcgtggcgctggcggcctacggggccgccgccggcctgcgggtg
gacatcgccattgcgcccacctgcccgccgcggcaacgcgccgccatggaacacttcggc
gcgcgcctgcacagcttcgccgacagcctggcgtgctggccctacgtggcgacgctatgc
cgcgacgagggcgcgttcgccggcaccaactatctcaacccgccggtcggcacccaccct
tacggcgtggagggctacaagccgatcgccgccgaactcgctgcccagtgcgacaacctg
cccaccgacatcatcgtgcccacggcccggggcgatctgctgtggggcatctgcctgggc
tggcaggcgctgttgcggcgcggcgcgatcgcgcggctgccacgcctgcatgcggtggaa
ccctatccccgcctggcgcacgcgctggccgccggcgatgcgcgcggtgtgtgggaacag
ccgacggcgcagtattccatcgccggcggcaccgcgaccctgcaatcgatgcaggccctg
gtgcgcagcggcggacaggccgtggatgtcgcggacgaacaggccgtggatgtcgcggac
gaacaggccgtggatgtcgcggacgaacaggccgtggatgtcgcggacgaacaggccgtg
gatgtcgcggacgaacaggccgcgcgggcccgcgcggcgctgggcgcgctgggcatcgcc
gccgagctgtcgtcggccgcggcgcttgccgccgtgccggcgctcaaggctgccggcgcg
ctggacgccgggtcgcgcgtggcgctgatcctgacctcggacgggcggcgcgactaa

DBGET integrated database retrieval system