KEGG   Bordetella pertussis 18323: BN118_2820Help
Entry
BN118_2820        CDS       T02296                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bper  Bordetella pertussis 18323
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bper00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bper00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3078904..3079407
Genome map
AA seq 167 aa AA seqDB search
MPMSATPLLSLVVAYSTNRVIGRDNALPWKLPGDLAHFKRTTLGHPIIMGRNTWESLGRP
LPGRTNIVITRNPAYDAAGAVVVGSLAAAIQACGDAAVACVIGGAQIYAQALPLAQRVVA
TEVHAEIEGDAFFPPLPAGQWRETQRAAQPAENGLRYDFVEYERVAG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttgcccatgtccgccactcccctgctcagcctggtcgtcgcctattcgaccaaccgcgtc
atcggacgcgacaacgccctgccctggaagctgcccggcgacctggcgcacttcaagcgc
acgaccctcggccatcccatcatcatgggccgcaacacctgggaatcgctgggccgcccg
ctgccggggcgcaccaatatcgtgatcacccgcaacccggcctatgacgccgccggcgcc
gtggtggtgggctcgcttgccgccgccatccaggcctgcggcgacgccgccgtggcctgc
gtcatcggcggcgcgcagatctacgcccaggccctgccgctggcgcagcgcgtggtggcc
accgaggtgcatgccgagatcgagggcgacgctttcttcccgccgctgccggccgggcag
tggcgcgaaacgcagcgcgcggcgcaaccggccgagaacggcctgcgctacgacttcgtg
gaatacgagcgcgtggcgggctga

DBGET integrated database retrieval system