KEGG   Bordetella pertussis 18323: BN118_2820Help
Entry
BN118_2820        CDS       T02296                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00670  One carbon pool by folate
bper00790  Folate biosynthesis
bper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN118_2820 (folA)
   00670 One carbon pool by folate
    BN118_2820 (folA)
Enzymes [BR:bper01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BN118_2820 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CCJ64245
UniProt: A0A0T7CRS7
Position
3078904..3079407
Genome map
AA seq 167 aa AA seqDB search
MPMSATPLLSLVVAYSTNRVIGRDNALPWKLPGDLAHFKRTTLGHPIIMGRNTWESLGRP
LPGRTNIVITRNPAYDAAGAVVVGSLAAAIQACGDAAVACVIGGAQIYAQALPLAQRVVA
TEVHAEIEGDAFFPPLPAGQWRETQRAAQPAENGLRYDFVEYERVAG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttgcccatgtccgccactcccctgctcagcctggtcgtcgcctattcgaccaaccgcgtc
atcggacgcgacaacgccctgccctggaagctgcccggcgacctggcgcacttcaagcgc
acgaccctcggccatcccatcatcatgggccgcaacacctgggaatcgctgggccgcccg
ctgccggggcgcaccaatatcgtgatcacccgcaacccggcctatgacgccgccggcgcc
gtggtggtgggctcgcttgccgccgccatccaggcctgcggcgacgccgccgtggcctgc
gtcatcggcggcgcgcagatctacgcccaggccctgccgctggcgcagcgcgtggtggcc
accgaggtgcatgccgagatcgagggcgacgctttcttcccgccgctgccggccgggcag
tggcgcgaaacgcagcgcgcggcgcaaccggccgagaacggcctgcgctacgacttcgtg
gaatacgagcgcgtggcgggctga

DBGET integrated database retrieval system