KEGG   Bordetella pertussis 18323: BN118_2893Help
Entry
BN118_2893        CDS       T02296                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bper  Bordetella pertussis 18323
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bper00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3158598..3159209
Genome map
AA seq 203 aa AA seqDB search
MKLIGSLTSPYVRKVRVVMAEKKLDYQLELENVWSPDSQVQKYNPLGKVPCLVMEDGGAL
FDSRVIVEYLDTLSPVARLIPQPGRERAAVKCWEAIADGLLDACVTVVRERLRPAAQQSP
EWIERQYGKVRASLDAMDHSLGENAHCMGVNYSLADIAVGCALGYLNLRFADLDWRADHA
NLARLYEKLSARPSFVDSMPPTA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatcggctcacttaccagtccttacgtccgcaaagtgcgggtcgttatggca
gaaaagaagctggactaccagctcgagctggagaacgtctggtcgcctgattcgcaggta
cagaagtacaacccgctgggcaaggtaccctgcctcgtcatggaagacggcggcgcgctg
ttcgattcgcgcgtgatcgtcgaatacctcgataccctgtctccggtggcgcggctgatt
ccgcagccgggccgcgaacgcgcggccgtcaagtgctgggaagccatcgccgacggcctg
ctcgacgcctgcgtcaccgtcgtgcgcgaacgcctgcgcccggccgcgcagcaaagcccc
gaatggatcgagcgccagtacggcaaggtgcgcgccagcctggacgccatggaccacagc
ctgggcgaaaacgcccactgcatgggcgtgaactacagcctggccgacatcgccgtgggc
tgcgcgctgggctatctgaacttgcgctttgcggacctggactggcgcgccgatcacgcc
aacctggcccgcctgtatgaaaagctgtcggcacgcccatccttcgtcgacagcatgccg
ccgaccgcctga

DBGET integrated database retrieval system