KEGG   Bordetella pertussis 18323: BN118_2943Help
Entry
BN118_2943        CDS       T02296                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bper  Bordetella pertussis 18323
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN118_2943 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN118_2943 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BN118_2943 (glcB)
Enzymes [BR:bper01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BN118_2943 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3226168..3228345
Genome map
AA seq 725 aa AA seqDB search
MTERIPHHGLQVAASLHRFIEDEALSGSGLAPDEFWAGFAALVRDLAPRNRELLAERDRL
QGEIDAWHRAHPGPVRDSAGYQALLERIGYLQPQPAQVTASTRDVDSEIASQAGPQLVVP
VSNARYALNAANARWGSLYDALYGTDAIPPVAGDDGKGYNPARGEAVIARARAFLDEAAP
LAQGSHADATAYAIEGGKLVVTLGAGQRTGLRNPAQLAGYQGDASQPAAVLLANNGLHFE
IQIDRQHQIGATDAAGVKDVLLEAALTTIMDCEDSVAAVDADDKVLIYRNWLGLMKGDLS
ESVTKGGKTFTRRLNADRQYHKPDGGTLTLHGRSLMFVRNVGHLMTNPAILDEQGSEVPE
GILDAVITSLAALPDRANRLNSRTGSIYIVKPKMHGPAEAAFANELFDRVEDLLKLPRHT
IKMGIMDEERRTSVNLKACIAAAAARVAFINTGFLDRTGDEMHTGMEAGPMLRKGDMKSS
AWITAYERNNVLVGLDCGLRGRAQIGKGMWAMPDMMAAMLEQKIGHPKAGANTAWVPSPT
AATLHAMHYHQVDVAAVQQALEQTRYDSVRDELLAGLLTVPVGDPAAWSADDIQRELDNN
AQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLRHGIVDRAQVNAT
FERMAKVVDQQNAGDPNYLPMAGHFDTSFAYRAACALVFEGLTQPNGYTEPLLHEYRQAF
KAARR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcatcccgcatcatggcctgcaagtggcggcctccctgcaccgtttcatc
gaagacgaggcgctgtccggcagcggcctggcgcccgacgagttctgggctggcttcgct
gccctggtgcgcgacctcgcgccgcgcaaccgcgaactgctggccgagcgcgaccgcctg
cagggcgaaatcgacgcctggcaccgcgcccatcccggccccgtgcgcgacagcgccggg
tatcaggcgctgctcgaacgcatcggctacctgcagccccagccggcacaggtaaccgcc
agtacccgcgacgtggacagcgagatcgccagccaggccggcccgcagctggtggttccc
gtctccaacgcgcgctatgcgctgaacgcggccaacgcccgctggggcagcctgtacgac
gcgctctatggcaccgacgcgatcccgccggtggccggcgatgacggcaagggctacaac
ccggcgcgcggcgaagccgtgatcgcccgcgcgcgcgccttcctggacgaggcggcgccg
ctggcccagggttcgcacgccgacgccaccgcctacgccatcgagggtggcaagctggtg
gtcacgctgggcgccggccagcgcacgggcctgcgcaaccccgcgcaactggccggctat
cagggcgacgcctcgcaaccggccgccgtgctgctggccaacaacggcctgcacttcgaa
atccagatcgaccgccagcaccagatcggcgccaccgatgccgccggcgtcaaggacgtg
ctgctcgaggccgccctgaccaccatcatggattgcgaagactccgtggcggccgtcgat
gccgacgacaaggtactgatctaccgcaactggctcgggctcatgaagggcgacctgagc
gaatcggtcaccaagggcggcaagaccttcacccgccgcctgaacgccgaccgccagtac
cacaagcccgacggcggcaccctgacgctgcacggccgctcgttgatgttcgtgcgcaac
gtcggccacctgatgaccaacccggccatcctcgacgagcagggcagtgaagtgccggaa
ggcatcctggatgcggtgatcaccagcctggccgctctgcccgaccgcgccaaccggctc
aactcgcgcaccggctcgatctacatcgtcaagcccaagatgcacgggccggccgaggcc
gccttcgccaacgagttgttcgaccgcgtcgaggacctgctcaagctgccgcgccacacc
atcaagatgggcatcatggacgaagagcggcgcaccagcgtcaacctgaaggcctgcatc
gcggccgcggcggcgcgcgtggctttcatcaacaccggattcctggaccgcaccggcgac
gaaatgcataccggcatggaggccggcccgatgctgcgcaagggcgatatgaaatccagc
gcctggatcaccgcctacgagcgcaacaacgtgctggtcgggctggactgcggcctgcgc
gggcgcgcccagatcggcaagggcatgtgggccatgcccgacatgatggcggccatgctc
gaacagaagatcggccaccccaaggcgggcgccaacacggcctgggtgccctcgcccacg
gccgcgaccctgcacgccatgcactatcaccaggtcgacgtcgcggccgtgcagcaggcg
ctggagcaaacccgctacgacagcgtgcgcgacgaactgctggccggcctgctgaccgtt
ccggtaggcgatccggccgcctggtcggccgatgacatccagcgcgagctcgacaacaac
gcccagggcatcctgggctacgtggtgcgctggatcgaccagggcgtgggatgctcgaag
gtgcccgacatcaacaacgtcggcctgatggaagaccgcgccaccctgcgcatctccagc
cagcacatcgccaactggctgcgccacggcatcgtcgaccgcgcacaggtcaacgccacg
ttcgaacgcatggccaaggtcgtcgaccagcaaaacgccggcgatcccaactacctgccc
atggccggccacttcgacacctcgttcgcctaccgcgcggcgtgcgcgttggtattcgag
ggcctgacccagcccaacggctacaccgagcccctgctgcacgagtaccggcaagccttc
aaggcggcccggcgctga

DBGET integrated database retrieval system