KEGG   Bordetella pertussis 18323: BN118_3563Help
Entry
BN118_3563        CDS       T02296                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bper  Bordetella pertussis 18323
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN118_3563 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN118_3563 (murA)
Enzymes [BR:bper01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BN118_3563 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3858756..3860024
Genome map
AA seq 422 aa AA seqDB search
MDKLRITGGSPLRGEVTVSGAKNAALPILCASLLTAEPLVLGNVPQLNDTSTTLRLLGRM
GVRAERAGDGTVTLQADQVDNLEAPYELVKTMRASILVLGPLLARFGQARVSLPGGCAIG
QRPVDQHIKGLATLGAEIEIEHGFVVARATRLKGASIRTDMVTVTGTENLLMAAVLAEGQ
TVLENAAREPEVVDLAELLIKMGARIQGHGTDRIVVDGVARLHGARHDVIADRIEAGTFL
CAVGAAGGDITLRGAAPDTMGATLDKLVEAGLTIETGPDWIRGAMHGRPRAVGARTHEYP
GFATDMQAQLMALDTVADGTAVIVENIFENRYMHVQELCRLGADIDIDGHTAVVRGVARL
SGATVMATDLRASASLVIAGLAAEGETLVDRIYHLDRGYDRMEVKLRALGASIQRVTGKE
TA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactgcgcatcaccggcggctcgcccctgcgtggggaagtcaccgtctcgggc
gccaagaacgcggccctgcccatcctgtgcgccagcctgctcaccgccgagccgctcgtg
ctgggcaatgtgccgcaactgaacgacacctcgaccacgctgcgcctgctgggccgcatg
ggcgtgcgcgccgaacgcgccggcgacggcaccgtcaccctgcaggccgaccaggtcgac
aacctggaagcgccgtacgagctggtcaagaccatgcgcgcctcgatcctggtgctgggc
ccgctgctggcccgcttcggccaggcccgcgtcagcctgccgggcggctgcgcgatcggc
cagcggccggtcgaccagcacatcaaggggctggcgacgctgggcgccgagatcgagatc
gagcacggcttcgtggtggcgcgcgccacgcgcctgaagggcgcctcgatccgcaccgac
atggtcaccgtcaccggcaccgagaacctgctgatggcggcggtgctggccgaaggccag
accgtgctggaaaatgccgcgcgcgaacccgaagtggtcgacctggccgagctgctcatc
aagatgggcgcgcgcatccagggccacggcaccgaccgcatcgtcgtcgatggcgtcgcg
cggctgcacggcgcgcgccacgacgtcattgccgaccgcatcgaggccggcaccttcctg
tgcgcggtaggcgcggcaggcggcgacatcacgctgcgcggcgccgcgcccgacaccatg
ggcgccacgctggacaagctggtcgaggccggcctgaccatcgaaaccgggccggactgg
atccgcggcgccatgcacggccgccctcgcgccgtcggcgcgcgcacgcacgagtatccc
ggtttcgccaccgacatgcaggcccagctgatggcgctggacacggtcgccgacggcacc
gccgtcatcgtcgagaacatcttcgagaaccgctacatgcatgtgcaggagctgtgccgc
ctgggcgccgacatcgacatcgacggccataccgccgtcgtgcgcggggtcgcccggctg
tccggcgccaccgtcatggccaccgacctgcgcgcctcggccagcctggtgatcgccggc
ctggccgccgagggcgagaccctggtcgaccgcatctaccatctcgatcgcggttacgat
cggatggaagtcaaactgcgcgccctgggcgcgagcattcaacgcgtaactggcaaggaa
acggcatga

DBGET integrated database retrieval system