KEGG   Bordetella pertussis 18323: BN118_3671Help
Entry
BN118_3671        CDS       T02296                                 

Gene name
ruvA
Definition
(GenBank) holliday junction DNA helicase
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bper  Bordetella pertussis 18323
Pathway
bper03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bper00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BN118_3671 (ruvA)
Enzymes [BR:bper01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BN118_3671 (ruvA)
DNA repair and recombination proteins [BR:bper03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BN118_3671 (ruvA)
    RecFOR pathway proteins
     BN118_3671 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_8 5_3_exonuc HHH_3 Transposase_20 Cdd1
Motif
Other DBs
NCBI-ProteinID: CCJ65096
UniProt: A0A0T7CTP0
Position
complement(3961187..3961759)
Genome map
AA seq 190 aa AA seqDB search
MIGRITGTLIEKSPPVVCVDVNGVGYEIDVPMSTLYALPETGARVTLFTHLVVREDAQLL
YGFGSSAERSTFRELIKVTGIGARTALAVLSGLSVAELSQAITLQETGRLTRVPGIGKKT
AERLLLEMRGKLGADIGATPHAASGHQSDILNALLALGYSDKESQAALKKLPDGVDVSEG
IRLALKALVR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcattaccggaaccctcatcgagaaatcgccgcccgtcgtctgtgtcgac
gtcaacggagtgggctatgaaatcgatgtccccatgagcaccctgtatgcgctgcccgag
accggcgcgcgggtcaccctgttcacccacctggtggtgcgcgaggatgcgcagctgctg
tacgggttcggcagcagcgccgagcgcagcacgttccgcgagctgatcaaggtgaccggc
atcggcgcgcgcaccgcgctggcggtcctgtcggggctctcggtggccgagctgtcgcag
gccatcacgctgcaggagaccgggcgcctgacgcgcgtgccgggcatcggcaagaagacc
gcggagcgcctgctgctggagatgcgcggcaagctgggcgcggacatcggcgccaccccg
cacgcggccagcggccaccagagcgatatcctcaacgcgctgctggcgctgggctactcc
gacaaggaatcccaggcggcgctcaagaagctgcccgacggggtggacgtgtcggaaggc
atccgcctggcgctcaaggccctggtccgctag

DBGET integrated database retrieval system