KEGG   Bordetella pertussis 18323: BN118_3683Help
Entry
BN118_3683        CDS       T02296                                 

Definition
(GenBank) putative UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00040  Pentose and glucuronate interconversions
bper00052  Galactose metabolism
bper00500  Starch and sucrose metabolism
bper00520  Amino sugar and nucleotide sugar metabolism
bper01100  Metabolic pathways
bper01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN118_3683
   00052 Galactose metabolism
    BN118_3683
   00500 Starch and sucrose metabolism
    BN118_3683
   00520 Amino sugar and nucleotide sugar metabolism
    BN118_3683
Enzymes [BR:bper01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN118_3683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: CCJ65108
UniProt: A0A0T7CTZ2
Position
complement(3972936..3973844)
Genome map
AA seq 302 aa AA seqDB search
MIARGGKKFAASTNFPALPPGVFMQVVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPL
IQYAVEEAVAAGITDLIFVTGRNKRAIEDHFDAAPELETDLEAKGKHELLALVRDILPAH
VNCLYIRQSAPLGLGHAVLTAAPAVGNEPFAVLLADDLIDADTPVLKQLIDVAVARQGSV
LGVQEVPREDTRKYGIVASQPVDARTERVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDH
LRATTVGAGNEIQLTDGIAALLRERDVYAHRYDGKRYDCGSKAGMFQATVALGRKYHGLI
PE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatagccagaggtggtaaaaagtttgccgcttcgacaaattttcccgcacttccccct
ggagttttcatgcaagttgtccgcaaagccgtctttcccgtggccggtatgggcacccgt
tttctgcccgccaccaaggccatgccgaaggaaatgctgccggtcgtggacaaacccctg
atccaatatgccgtcgaagaggccgtcgccgctgggatcaccgacctcatcttcgtcacg
ggccgcaacaagcgggccatcgaagaccatttcgatgccgcccccgagctggaaaccgac
ctggaagcgaagggcaagcacgaactgctggcgctggtccgcgacatcctccccgcgcac
gtgaactgcctgtacatccgccaatcggccccgctgggcctgggacatgccgtgctgacg
gccgcgccggcggtaggcaacgagcccttcgcggtgctgctggccgatgacctgatcgac
gccgacacgccggtgctcaagcagctgatcgacgtggcggtggcgcgccagggcagcgtg
ctgggcgtacaggaggtgccgcgcgaagacacgcgcaaatacggcatcgtggccagccag
ccagtcgatgcgcgcaccgagcgtgtcacccacatcgtcgagaaacccgcccccgagcaa
gcccccaccaccctggcggtcgtcggccgctatgtgctggaggcagccattttcgaccat
ctgcgtgccaccacggtcggggcgggcaatgaaatccagctgacggacggtatcgccgcg
ctgctgcgcgaacgcgacgtctatgcgcaccgctatgacggcaagcgctatgactgcggc
agcaaggcgggcatgttccaggccaccgtggccctgggccgcaaataccacggcctgatt
ccggaataa

DBGET integrated database retrieval system