KEGG   Bacillus pseudofirmus: BpOF4_00015Help
Entry
BpOF4_00015       CDS       T01165                                 

Gene name
dxr2
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00900  Terpenoid backbone biosynthesis
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01130  Biosynthesis of antibiotics
Module
bpf_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BpOF4_00015 (dxr2)
Enzymes [BR:bpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BpOF4_00015 (dxr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADC48072
UniProt: D3FSD1
Position
complement(2289017..2290165)
Genome map
AA seq 382 aa AA seqDB search
MKKISLLGATGSIGTQTLDVIKHHSDQFSLIAMSVGRNINLALDQINMFKPSIVSVMTQE
DAQKLQLQISDEIKVVYGEEGLIEVAANNEADILVNAVIGSVGLAPTLKAIEAGKTIAIA
NKETLVTAGHIVTDAAKKHQVPLLPVDSEHSAIFQALNGESSSEVDRLILTASGGSFRDK
TRDELNGVTVEEALNHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYDNIDVVLHKE
SIIHSMVEFVDRSVIAQLGTPDMKVPIQYALTYPNRLEASNSERLNLWEIGTLNFSKLDT
ERYRCMKFAYEAGRIGGTMPTVLNAANEEAVAAFLDGKITFLDIEDQIEQALERHEKINH
PTLDVIKEVDRETRKFIHSLRN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagattagtttattaggtgcgacaggttctataggaacacaaactcttgatgtg
attaaacaccattctgatcaattttcacttattgcgatgtctgtagggcgtaatataaac
cttgcgctcgatcaaatcaatatgtttaaaccatcgattgtctctgtaatgacacaagag
gatgcacaaaaactacagcttcaaatatctgatgaaatcaaagtcgtatatggtgaagaa
ggattaattgaagtagctgccaataacgaagcagatattttagtcaatgcagtgataggc
agtgtagggctcgctcctacactaaaagcaatcgaagcaggtaagacaattgcgattgca
aataaagagacactagtcacagcaggacatatagtaacagatgcggccaaaaaacatcag
gttcctctcttaccagttgatagtgagcattcagctatttttcaagcattaaatggtgag
agttcatcagaggtcgatcgccttattttaacggcctcaggcggaagtttccgtgacaaa
acaagagacgagcttaatggagtgacagtagaggaagctcttaatcaccctaactggtca
atgggagcaaagattaccattgattctgcgacaatgatgaataaagggctagaagtaatt
gaggcgcactggctgtttgatattccatacgacaatattgatgtagttcttcataaagaa
agcattattcattcaatggttgagtttgtggatagaagcgtcattgcccagttagggaca
cctgatatgaaagtgcccattcaatatgcgctgacctacccaaaccgactagaagcttct
aacagtgaacgattaaatctgtgggagattggaacgctgaatttttccaaactagataca
gaacgttatcgctgcatgaagtttgcttatgaagcgggaagaatcggcgggacgatgcca
acggttttaaatgctgcgaatgaagaagcagtagctgcctttctagatggtaaaattaca
tttctagacatagaagatcagattgaacaagctctagagcggcacgaaaaaattaatcac
ccgacacttgatgtgattaaagaagtagatcgtgagacgagaaagtttatccactcgtta
cgtaattaa

DBGET integrated database retrieval system