KEGG   Bacillus pseudofirmus: BpOF4_00460Help
Entry
BpOF4_00460       CDS       T01165                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bpf  Bacillus pseudofirmus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bpf00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2371841..2372455)
Genome map
AA seq 204 aa AA seqDB search
MKKEKGLLIVLSGPAGVGKGTVCGALRKEETDIQYSVSATTRQPREGEVNGVNYFFKSRD
QFEEMIKNDQLLEWAEYVGNYYGTPVDYVRQTLDNGQDIILEIEVQGALKVREKFPEGVF
IFLMPPSLAELRARIVGRGTETEEVINKRMTVAREEIDMMKKYDYVVENDQVDLAVDRIK
SIVVAEHCKRERLIEKYKELVEVD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaaaagggtttattaattgtattatctggcccagcaggcgttgggaaaggg
acggtttgcggagcattacgtaaagaggaaacagatattcaatattctgtttctgccaca
accaggcagccgagagaaggagaagtgaatggagttaattacttctttaagagccgtgat
caatttgaagaaatgattaaaaatgatcaattactagaatgggcagagtatgtcggtaac
tattacggtacgccagttgattatgtgaggcagacgcttgataatggacaagatattatc
ttagagattgaggttcaaggagctttgaaggttcgtgaaaagttcccagaaggcgtgttt
attttccttatgcctccgagcttagctgagctaagagcgcgtattgtagggcgcggcacg
gaaactgaagaagtgattaataagcggatgactgttgcaagggaagaaattgacatgatg
aaaaaatacgattacgtcgtagaaaatgatcaagtagaccttgctgtggatcgaattaaa
tccattgttgttgctgaacattgtaaaagagaaagacttattgaaaaatataaagagtta
gtggaggttgactaa

DBGET integrated database retrieval system