KEGG   Bacillus pseudofirmus: BpOF4_00700Help
Entry
BpOF4_00700       CDS       T01165                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bpf  Bacillus pseudofirmus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bpf00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bpf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2420508..2421971)
Genome map
AA seq 487 aa AA seqDB search
MMKLSELTNVLRSYEWKNEGDPEITHIEMDSREVVSGTLFFCIKGYTVDGHDFAKQAVEK
GAVALIAEREVKGVEVPTIIVQDTKRTMARLANLFYGDPTSKMNLIGVTGTNGKTTVTHL
LEQIMNDANKRTGLIGTMYTKIGDVELKTQNTTPESITLQKRFKEMVDADVETALMEVSS
HALHLGRVRGCDFDIAVFTNLTPDHLDYHETMEAYLFAKGLLFAQLGNRFTEGKVAVLNR
DDEAADELLKMTTVDVLTYGVENKADIMAEDIEITARGTTFTLKAGTESIEIEMKLIGMF
SVYNALAAASAAIASGIPLEQIKKSLEAVHGVAGRFEPVDAGQDYTVIVDYAHTSDSLEN
VLTTVREFAKGKISVVVGCGGDRDRTKRPVMAEIATKYADNAIFTSDNPRSEDPKQILDD
MTHGLESSNYTVCVDRKEAIYQAINDANKDDILVIAGKGHETYQIIGANTTHFDDREVAK
QAIEERV
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattaagcgaattaacgaacgtgttaagatcatatgaatggaaaaatgaaggg
gatccagagattactcatattgaaatggattctagagaagtcgtttcgggaacattgttt
ttctgtattaaaggatatacagtggatggccacgattttgcaaaacaagcagttgaaaaa
ggggcagttgctcttattgctgagcgtgaagtcaaaggtgtcgaggtgccaacgatcatt
gtgcaagatacgaagcgtacaatggctcgtcttgctaatctattttacggagatcccaca
tctaaaatgaatttaattggggttacaggaacaaatggtaaaacgaccgtcacccattta
cttgaacaaataatgaatgatgccaataaaagaacaggtcttatcggtaccatgtacact
aaaattggtgatgtagagctgaaaacccaaaatacaacaccggaatcgatcactttgcaa
aagaggtttaaagaaatggtagatgctgatgtagagacagcattaatggaagtctcttca
catgctcttcatctaggccgtgttcgggggtgtgactttgatattgcggtattcacaaat
cttacacctgaccatcttgattatcatgaaacgatggaagcctatctttttgctaaaggg
cttttgtttgctcagctcggaaatcgtttcactgaaggaaaagttgcagtgttaaatcgt
gacgatgaagcagccgatgaattacttaaaatgacgacggtagatgtccttacatatggt
gtggaaaataaggcagacattatggcagaggatatcgagattacagcaaggggaacaaca
tttacacttaaagcaggaacagagtcaattgaaatagagatgaagcttattggtatgttt
agtgtgtataatgcgttagctgcagcaagtgcagccattgcatccggtattcctttagaa
caaattaagaaaagcttagaagctgtacacggagtagcaggccgttttgaaccggtcgat
gcaggccaagattatactgttattgttgactacgcacacacttcagacagcttagagaat
gtattaacaacagtgagggaatttgcaaaagggaaaatatctgttgtggtcggatgcgga
ggagacagagatcgcacaaagcgtccagtaatggcggaaattgccacaaaatatgctgat
aatgcgatcttcacttcagataatccgaggtcagaagatccaaagcaaattcttgatgac
atgactcatgggctcgaatcttcaaattatacagtttgcgtagaccgaaaagaagcgatc
tatcaagcaattaatgatgcaaacaaggatgatattttagttattgcaggaaaaggtcat
gaaacctatcagattattggtgctaatacaacccactttgatgatagagaagtagcaaaa
caagcaattgaggagagggtgtaa

DBGET integrated database retrieval system