KEGG   Bacillus pseudofirmus: BpOF4_00955Help
Entry
BpOF4_00955       CDS       T01165                                 

Gene name
glsA
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bpf  Bacillus pseudofirmus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpf00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpf00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bpf00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2465630..2466553)
Genome map
AA seq 307 aa AA seqDB search
MVCQYGEQLEKLVKEAEPYAAEGKVADYIPALAKADQGILAVSIFDGKETCFSAGHSTEM
FTLQSISKVLTLALALMDHGEEVVFDKVGMEPTGDPYNSIAKLESLVAKPLNPMINAGAL
AVSHLIKGESTEERLERLLQLIRKMSARPSVTYNREVAQSEFNTADLNRSLAFFMKQHRI
IDENVDQLLDFYTKQCAIEVDCDDLARIGFVLANGGKNEEGEEIIPFEIARLVKTFMVTC
GMYNSSGEFAIRVGIPAKSGVSGGIVGAVPNSIGIGIYGPALDEKGNSVAGMKLLEALSS
YYHLSIF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggtctgtcagtacggtgaacagttagagaagttagtaaaagaagcagaaccatatgct
gcagagggcaaagtggcagattatatacctgcgctagctaaagcagatcaaggtatttta
gccgtctcaattttcgatggcaaagaaacatgtttttcagcaggtcactcaaccgagatg
ttcacattacaaagtatttcgaaagtgcttactttagcccttgccttaatggaccatggg
gaggaagtcgtttttgataaagtagggatggaacctacgggagatccttacaattcaata
gcaaaattagagtcgcttgtcgccaaaccgcttaatccaatgatcaatgcaggagccttg
gccgtcagtcacctcataaaaggtgaatcaacagaagagaggcttgagaggcttcttcaa
ttgattagaaaaatgagcgcacgtcctagtgtgacctataatcgtgaagttgcacaatct
gaatttaacacagctgatcttaatcgctcccttgctttttttatgaagcaacatcgaatt
attgatgaaaacgttgaccaattattagacttttatactaagcagtgtgccattgaagtc
gattgtgatgatttggcgagaatcggatttgtgttagctaatggcggtaaaaatgaagaa
ggtgaagagattattccgtttgaaattgcaagacttgtgaaaacatttatggtcacttgc
ggcatgtataattcatcaggagagtttgctatcagagtaggaattccggcaaaaagcggt
gtgtctggcggaattgttggtgctgtacctaatagcattggtataggtatttatggcccg
gcattagatgagaaggggaatagtgtggctggaatgaagctgcttgaggcattgtctagt
tattatcacttgagtattttctaa

DBGET integrated database retrieval system