KEGG   Bacillus pseudofirmus: BpOF4_01340Help
Entry
BpOF4_01340       CDS       T01165                                 

Gene name
aceB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bpf  Bacillus pseudofirmus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BpOF4_01340 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BpOF4_01340 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BpOF4_01340 (aceB)
Enzymes [BR:bpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BpOF4_01340 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2536946..2539132)
Genome map
AA seq 728 aa AA seqDB search
MTKYLKVGNLQVAPVLYEFINKKALPQSGVNEQEFWSGLETLITEFAPGNRQLLDDREDL
QQKIDNWHKENKETFDFNQYKTFLQEIGYLEPKVEEFKITTENVDNEIALQAGPQLVVPV
NNARYALNAANARWGSLYDALYGTDVISEENGQEKGKAYNPVRGEKVIAMAKEFLDETAP
LSNGSHKDAEKYTVEGGTLVVHSNGVTSELKESSQFVGYQGTTEDPSILLLKNNGLHFEI
QIDREHPIGKTDRAGVKDVVMEAAITTIMDCEDSVAAVDAEDKVGVYTNWLGLMKGDLEE
TFTKGGQSVTRALQKDRNYTTATGDTLTLSGRSLMFVRNVGHLMTNNAILDENGNEVPEG
ILDCMVTSLIAKHDLLNNSKVQNSTKGSIYIVKPKMHGSKEVAFSNQLFNRVEDLLGLER
HTIKIGVMDEERRTSLNLKACIKEVKDRVVFINTGFLDRTGDEMHTSMEAGAMIRKNDMK
GSTWLQSYEKSNVNTGLDCGLPGRAQIGKGMWAMPDLMAEMLKQKDGQLKAGANTAWVPS
PTAATLHAMHYHKVNVANVQEELKSTIQDLQDQILDIPLAKETNWSAEEVQQELDNNAQG
ILGYVVRWVEQGVGCSKVPDINNIGLMEDRATLRISSQHVANWLHHGICSKEQVLETLKR
MAKVVDQQNAGDPTYRPMADDYENSVAFQAALELVLKGCEQPSGYTEPILHRRRIEFKEK
VDSVAQTK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtatttgaaagttggtaatttgcaagtagcaccagtactttatgagtttatt
aataagaaggctctcccgcaaagcggcgtcaatgaacaagaattctggtctggtttggaa
acgttaattactgagttcgcaccaggaaatagacaactgcttgacgatagagaggacctc
cagcaaaaaatcgacaattggcacaaagaaaataaagaaacatttgattttaatcaatat
aaaacgttcttacaagaaattggttatcttgaaccgaaagtagaagagtttaagattaca
acagagaatgtggataatgaaattgcgctgcaagcaggtcctcaactagttgtaccagta
aataatgcacggtatgccttaaacgcagctaatgcgcgctggggaagtttatatgatgca
ttatatggtacagatgtgatttctgaagagaatggtcaagaaaaagggaaggcatacaat
cctgtacgcggtgagaaagtcattgccatggctaaggaatttctagatgaaacagctcca
ttatctaacgggtcgcataaagatgcagaaaaatatacagtcgaaggtggaacgctggtt
gtacatagtaacggggtgacatctgaattaaaagagtcatcacaatttgtagggtatcaa
gggacaacagaagacccgtctattctgttgctaaagaacaatggtcttcattttgagata
caaattgaccgagaacatcctattgggaaaacggaccgagcaggagttaaagatgtggtg
atggaagctgcaattacaaccatcatggattgtgaagactctgttgcagcagttgatgca
gaagataaggtaggcgtttacacgaattggttagggttaatgaaaggtgatttagaagag
accttcacaaaaggtggtcagtctgtaacacgtgctcttcaaaaggatcgcaactataca
acagccacgggtgatacattgacactttccggaagatcacttatgttcgttcgtaatgta
ggacacttaatgacgaataatgcaatccttgatgaaaatggtaatgaagtgcctgagggt
attctagattgcatggttacaagtttaattgcgaagcatgacctgcttaataacagcaag
gttcaaaactctactaaaggttccatttatattgtaaaaccaaaaatgcacgggtcaaaa
gaagtggcattctctaaccaattatttaaccgcgtagaggatctgttaggccttgaacgt
catacgattaaaattggtgttatggatgaagaacgtcgtacatccctcaaccttaaagct
tgtataaaagaagttaaagacagagtggtattcattaatactggtttcttagatcgaaca
ggtgatgagatgcacacatctatggaagcaggtgcgatgatccgtaagaatgatatgaaa
gggtcaacttggctgcagtcttatgagaaatcaaatgttaatacagggctcgattgcgga
ttgccagggcgtgctcaaatcggcaaaggaatgtgggcaatgccagatcttatggcagag
atgcttaaacaaaaagatggtcagttaaaggcaggagcgaacacggcttgggtgccttca
ccaacggcagctactctgcatgctatgcattaccataaagtaaatgtggcaaatgtacaa
gaagaattgaagagtacgattcaagacttacaagatcaaattttagacattcctcttgca
aaagaaacaaattggagtgcagaagaagtgcaacaagagttagacaataatgctcaaggg
attttgggctatgtagtccgttgggtagagcagggtgtcggttgttctaaagttccggat
attaataatatcggcttaatggaagatcgtgcgaccctgcgtatatcaagccagcacgta
gcaaactggctgcatcatggaatttgttccaaagagcaggtgttagaaacgttaaaacgt
atggcgaaggttgtagatcagcaaaatgccggcgatcctacttatcgtccgatggcagat
gactacgagaactccgttgcttttcaagcagcacttgagctagtattaaaaggatgcgaa
cagcctagcgggtacacggagcctatccttcatagacgtcgtattgaatttaaagaaaaa
gtagatagtgtagctcaaacaaaataa

DBGET integrated database retrieval system