KEGG   Bacillus pseudofirmus: BpOF4_03545Help
Entry
BpOF4_03545       CDS       T01165                                 

Gene name
acsA
Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00010  Glycolysis / Gluconeogenesis
bpf00620  Pyruvate metabolism
bpf00640  Propanoate metabolism
bpf00680  Methane metabolism
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01120  Microbial metabolism in diverse environments
bpf01130  Biosynthesis of antibiotics
bpf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BpOF4_03545 (acsA)
   00620 Pyruvate metabolism
    BpOF4_03545 (acsA)
   00640 Propanoate metabolism
    BpOF4_03545 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BpOF4_03545 (acsA)
Enzymes [BR:bpf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BpOF4_03545 (acsA)
Lipid biosynthesis proteins [BR:bpf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BpOF4_03545 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF2577 Atu4866
Motif
Other DBs
NCBI-ProteinID: ADC48775
UniProt: D3FX20
Position
complement(2981445..2983037)
Genome map
AA seq 530 aa AA seqDB search
MEREQLIAPEIYNLSHEVERYAKDTERIAIDWSDDKNNRRIISYPELVAQTNRFANALLS
QGLKQGDKVLLILPRVPEAYFSYLACLKAGLVIIPCSEMLRAKDLAYRINHAEAKAVIAY
TGFTDEIQSLGDSTPTLHAKLIVGQTLEGWVDLVAAAENESDYYEGAETKRDELAFLPYT
SGTTGNPKAVVHTHGWAYAHLQVASKMWLDVQEGDKVWATAAPGWQKWIWSPFLSTIGVG
ATAYVYHGRFDPNEYLQRLEDEKINVLCCTPTEYRLMAKVESIESYKLPELRSTVSAGEP
LNRQVIETFKKAFNVNVRDGYGQTENTLLIGTLQGMEIKPGSMGKPTPGNEVAIVDESGV
PVQPGEVGDIAVHKSAPALFREYYKDPERTAMAYRGDYYITGDQAKLDEDGYFWFEGRSD
DIIISSGYTIGPFEVEDALTKHPAVKECAVVASPDEIRGNVVKAFIVLRDEKAVADDQLV
AELQEHVKVMTAPYKYPRKIEFVNELPKTTSGKIRRIELRQQETAKYAEA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaacaacttatcgcaccagagatttacaatttatctcatgaagtagaacgt
tatgcaaaagacacagaacgaattgctattgattggtcagatgataagaataaccgccgc
atcatttcttaccctgaattagtagctcaaacaaaccgctttgcgaatgctctattaagc
caaggattaaagcaaggagataaggtccttcttattctaccaagggttcctgaagcttat
ttttcatacttagcatgtttaaaagcagggcttgtcattattccttgttctgaaatgctt
cgagcaaaagatttagcttatcgtattaatcatgcagaagcaaaagctgttattgcttac
actggatttacagatgaaattcagtctctcggggattctactcctacacttcacgctaaa
ctaatcgttggacaaacattagaaggatgggtagatctagttgctgcagctgaaaatgaa
agcgattactacgaaggtgcagaaacaaaaagagacgagcttgctttccttccttacaca
tctggtacaacaggaaatccaaaagcagttgtacatacacacggatgggcttatgctcac
ctgcaagtcgcttcaaaaatgtggcttgatgttcaagaaggagataaagtttgggcaaca
gcagctcctggctggcagaaatggatttggagtcctttcttatcaacgattggagtaggc
gcgacagcatatgtctaccatggccgctttgaccctaacgagtaccttcaacgtctagaa
gatgagaaaattaatgtattatgctgtacaccaactgaatatcgcctaatggctaaagtt
gaatcaattgaaagttataaattaccagagcttagaagtacagtttctgctggtgagcct
cttaaccgtcaagttattgaaacctttaaaaaagcattcaatgtaaatgttcgtgatgga
tacggacaaacagaaaataccttactcattggtacacttcaagggatggaaattaagcct
ggttctatgggcaagccgacacctggtaatgaggtagcgattgtggatgagagtggtgtt
ccggttcagccaggtgaagttggcgatatagctgtgcacaagagtgcccctgcattgttc
cgtgaatactataaagatcctgaacgtacagcgatggcgtatagaggagactactatatt
acaggagaccaagctaaattagatgaagatggatacttctggtttgaagggcgcagtgat
gatatcattatcagctctggatatacaataggaccttttgaagtagaagatgcccttaca
aagcacccagctgtgaaagagtgtgctgttgtagcttctcctgatgagattagaggtaat
gttgtaaaagcatttatcgtattaagagatgaaaaggcagtagctgatgatcaacttgta
gctgaattgcaagagcatgtgaaagtgatgacagcaccatataaatacccaagaaaaatt
gagtttgtaaacgagcttccaaagacgacatcagggaagattagacgtattgagcttcgt
cagcaagaaacagcgaaatatgcagaagcttaa

DBGET integrated database retrieval system