KEGG   Bacillus pseudofirmus: BpOF4_03715Help
Entry
BpOF4_03715       CDS       T01165                                 

Gene name
gpm
Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpf  Bacillus pseudofirmus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BpOF4_03715 (gpm)
   01230 Biosynthesis of amino acids
    BpOF4_03715 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BpOF4_03715 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BpOF4_03715 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BpOF4_03715 (gpm)
Enzymes [BR:bpf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BpOF4_03715 (gpm)
Exosome [BR:bpf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BpOF4_03715 (gpm)
  Exosomal proteins of melanoma cells
   BpOF4_03715 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3019912..3020439)
Genome map
AA seq 175 aa AA seqDB search
MNTEIYFLRHAHSDFSLENEETRELSAKGWATAKKITDKMIKEDIQYVISSPYVRAIQTV
EGLARYLHKEIELDSRFIERDLAARDFYFDKPLEAIKYVFDNPIFRFSGGESNQEVQERG
ISGLKHIVSKYRRKRVAVGIHGNIMTCTLNYFNKKFDYHFWRDSIDNLSRYYTYI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagagatatattttcttagacacgctcattctgatttttcattagaaaacgaa
gaaactagagagttatctgcaaaaggttgggctaccgcaaaaaagattactgacaaaatg
ataaaagaggatattcaatatgtaatatctagtccatatgtaagagcaatacaaacagta
gaaggactagcaaggtatctacataaagaaattgaactggattcccgttttatagagaga
gacttagcagcaagagatttttattttgataaaccacttgaagccattaaatatgtgttt
gataatcccatttttaggttttcgggtggtgaatctaatcaagaagttcaagaacgtggt
ataagtggtttgaagcatattgtttctaaatatcgtagaaaaagggtagcagtaggcatt
catggtaatatcatgacatgtacattgaattattttaataagaaatttgattatcatttt
tggagggattcaattgacaatctatcaagatattatacgtatatttga

DBGET integrated database retrieval system