KEGG   Bacillus pseudofirmus: BpOF4_03715Help
Entry
BpOF4_03715       CDS       T01165                                 

Gene name
gpm
Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpf  Bacillus pseudofirmus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BpOF4_03715 (gpm)
   01230 Biosynthesis of amino acids
    BpOF4_03715 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BpOF4_03715 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BpOF4_03715 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BpOF4_03715 (gpm)
Enzymes [BR:bpf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BpOF4_03715 (gpm)
Exosome [BR:bpf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BpOF4_03715 (gpm)
  Exosomal proteins of melanoma cells
   BpOF4_03715 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3019912..3020439)
Genome map
AA seq 175 aa AA seqDB search
MNTEIYFLRHAHSDFSLENEETRELSAKGWATAKKITDKMIKEDIQYVISSPYVRAIQTV
EGLARYLHKEIELDSRFIERDLAARDFYFDKPLEAIKYVFDNPIFRFSGGESNQEVQERG
ISGLKHIVSKYRRKRVAVGIHGNIMTCTLNYFNKKFDYHFWRDSIDNLSRYYTYI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagagatatattttcttagacacgctcattctgatttttcattagaaaacgaa
gaaactagagagttatctgcaaaaggttgggctaccgcaaaaaagattactgacaaaatg
ataaaagaggatattcaatatgtaatatctagtccatatgtaagagcaatacaaacagta
gaaggactagcaaggtatctacataaagaaattgaactggattcccgttttatagagaga
gacttagcagcaagagatttttattttgataaaccacttgaagccattaaatatgtgttt
gataatcccatttttaggttttcgggtggtgaatctaatcaagaagttcaagaacgtggt
ataagtggtttgaagcatattgtttctaaatatcgtagaaaaagggtagcagtaggcatt
catggtaatatcatgacatgtacattgaattattttaataagaaatttgattatcatttt
tggagggattcaattgacaatctatcaagatattatacgtatatttga

DBGET integrated database retrieval system