KEGG   Bacillus pseudofirmus: BpOF4_04110Help
Entry
BpOF4_04110       CDS       T01165                                 

Gene name
ytpA
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bpf  Bacillus pseudofirmus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bpf00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3109901..3110683)
Genome map
AA seq 260 aa AA seqDB search
MWKSEISEPRGVIVMVHGAGEHHGRYMWLAKKWNDHGFDVVMGDLPGQGKTRGTRGHVQS
FNQYLDAVDEWMLEAKKKDLPIILFGHSMGGLVCVRSLMERNHTHITGVILSSPCLGLSS
PPPKTKALATKLLHRVAPTFSAKSGLRTEHCTRNEEVREAYLKDELRVTRVTARWYQELT
KAMHLANRYPEKMPNLPILVMQSGEDYIVDQIAVRDWFDHLLLTEKSYKEWEGLYHEIFN
EPEREDVFRYAIGFVNILLP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatcagagatttctgagccgcgtggtgtaatcgtaatggtacacggagccggt
gagcatcacgggagatatatgtggcttgctaagaagtggaatgaccacggctttgatgtg
gtgatgggagacttgccaggtcaagggaagacaagaggtacaagaggccatgtgcaatca
tttaatcaatatttagatgcggttgatgaatggatgcttgaggcaaaaaagaaagattta
ccgattattttgtttggccatagtatgggaggtcttgtttgtgttcgttcgttaatggag
cgtaatcatactcatattactggagtaatcttatcttcaccttgcttaggattaagcagc
ccccctccaaaaacaaaggcattggctacaaagcttttgcacagagtcgcaccaaccttc
agtgctaaatctggattgcgtactgagcattgtacgcgcaatgaagaagtacgtgaagct
tatttgaaagatgaactgcgtgtaacgagggtgaccgctaggtggtatcaagagctgacg
aaagcgatgcaccttgccaaccgctatcctgaaaaaatgccgaatctgcctatattagtg
atgcagtctggtgaagattatattgtcgaccaaatcgctgtaagggactggtttgatcat
ttacttttaactgaaaagagttataaagaatgggaagggctgtatcatgaaatttttaat
gagccggaaagagaagatgtattcaggtatgccatcggatttgtaaacatcctccttcca
tag

DBGET integrated database retrieval system