KEGG   Bacillus pseudofirmus: BpOF4_05255Help
Entry
BpOF4_05255       CDS       T01165                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
bpf  Bacillus pseudofirmus
Brite
Enzymes [BR:bpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BpOF4_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 DLH Abhydrolase_1 BAAT_C Abhydrolase_6 Peptidase_S9 PhoPQ_related UPF0227 DUF2048
Motif
Other DBs
NCBI-ProteinID: ADC49113
UniProt: D3FY90
Position
complement(3305162..3305902)
Genome map
AA seq 246 aa AA seqDB search
MKVVAPKPFTFEGGDRAVLLLHGFTGTTADVRMIGRHLQKEGYTCHAPLYKGHGVPPEEL
VHTGPEDWWKDVEAGYNYLKEKGHEEIAVCGLSLGGVFSLKIGYTLPVKGIVPMCAPVRP
KTEDAMYKGVLAYAREYKKREQKSDDVINQEMEAFKPMGTLSALGELIQDVHNHLDHIYS
PTFVVQARNDEMIDVESANIIHDQIESDEKSLKWYEESGHVITLDKEKEQLHEDILQFLE
GLDWTV
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagtagcacctaagccatttacatttgaaggaggagaccgtgcggttcttctg
ttgcacggcttcactggaacaacggccgatgtgagaatgatcggacgccacttacaaaaa
gaagggtacacatgccacgcccctttatataaggggcacggagttcctcctgaagagctt
gttcatacaggtcctgaagattggtggaaggatgtagaggcaggctataactacctaaaa
gaaaaaggtcatgaggaaattgcggtgtgcgggctttctcttggcggggtattctccctg
aaaatcgggtacactttacctgtaaagggtattgtgccaatgtgcgctcccgttcgccca
aaaacagaggatgcgatgtataaaggcgttctagcctatgcccgtgagtacaaaaagcgt
gaacaaaagtcagatgatgtgatcaatcaagagatggaagcatttaaaccgatgggaacg
ctaagtgcccttggtgagttaatacaagatgttcacaatcatctcgatcatatttattct
ccaacttttgtggttcaggctaggaatgatgagatgattgacgtggaaagtgcaaatatt
atccatgatcaaatcgaatcagatgaaaaatcattaaaatggtatgaggaatcaggccat
gttattacattagataaagaaaaagaacagcttcatgaagatattcttcaatttttagaa
ggattagactggactgtatag

DBGET integrated database retrieval system