KEGG   Bacillus pseudofirmus: BpOF4_05280Help
Entry
BpOF4_05280       CDS       T01165                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00010  Glycolysis / Gluconeogenesis
bpf00051  Fructose and mannose metabolism
bpf00562  Inositol phosphate metabolism
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01120  Microbial metabolism in diverse environments
bpf01130  Biosynthesis of antibiotics
bpf01200  Carbon metabolism
bpf01230  Biosynthesis of amino acids
Module
bpf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bpf_M00002  Glycolysis, core module involving three-carbon compounds
bpf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BpOF4_05280 (tpiA)
   00051 Fructose and mannose metabolism
    BpOF4_05280 (tpiA)
   00562 Inositol phosphate metabolism
    BpOF4_05280 (tpiA)
Enzymes [BR:bpf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BpOF4_05280 (tpiA)
Exosome [BR:bpf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BpOF4_05280 (tpiA)
  Exosomal proteins of bladder cancer cells
   BpOF4_05280 (tpiA)
  Exosomal proteins of melanoma cells
   BpOF4_05280 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADC49118
UniProt: D3FY95
Position
complement(3310728..3311483)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAKQFVQEVKSNVPANSEVDAVVCSPALFLESLVSETNGTDLK
VGAQNVHFEENGAFTGEISPVALEDMNVAYVIIGHSERREMFAETDETVNKKVHAAFKHN
LVPIMCCGETDAEREAGKTNDVVREQVEKGLSGLTEDQVKETVIAYEPIWAIGTGKSSSA
ADANEVCAYIRKVVASNFSEDAANAVRIQYGGSVKPANIAEYMAQADIDGALVGGASLEP
KSFLELLEAGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagccaattatcgcaggtaactggaaaatgaataaaacgcttggcgaagcaaaa
caatttgtccaagaagtaaaatcaaacgttcctgctaacagcgaagtagatgcagtagta
tgctcacctgctttatttcttgaaagcctagtatctgaaactaacggtacagaccttaaa
gtaggagcacaaaatgtacattttgaagaaaatggcgcatttactggcgaaatcagccct
gttgctctagaagacatgaacgtagcttatgtgatcattggtcactctgagcgtcgtgaa
atgtttgctgaaacagatgaaacggtaaacaaaaaagtacatgctgcgttcaaacacaat
ttagtgccaatcatgtgctgcggtgaaacagacgcagagcgtgaagctggaaaaacaaat
gatgttgttcgcgagcaagtagaaaaaggtcttagcggcctgacagaagatcaagtaaaa
gaaactgttattgcttatgagccaatctgggcaatcggaacaggtaaatcatcttcagca
gcagatgcaaacgaagtatgtgcatacatccgtaaagtggttgcatctaacttctcagag
gatgctgcaaatgcagtacgtattcaatacggcggcagcgtgaagcctgcaaatattgca
gagtacatggcgcaagctgatattgacggcgcacttgttggcggagccagtcttgagcca
aaatcatttcttgagcttttggaggcaggtaaatga

DBGET integrated database retrieval system