KEGG   Bacillus pseudofirmus: BpOF4_05850Help
Entry
BpOF4_05850       CDS       T01165                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpf  Bacillus pseudofirmus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpf00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3438779..3439720)
Genome map
AA seq 313 aa AA seqDB search
MTENIYGNTPPFLGAINGTTESTEDSDVLIYGVPWEGAVTWGDYTGCELGPKVMRLCSGR
YSGYLPELDHIDVFEHLKLADMGDVDVVPADVIETMNRIESFSGDMWDSGKFPLALGGDH
GITYPIVKALTERTGKKVGILHLDAHYDNMPHHDGDKYARSTPFARLYELDGVRNESLIH
AGIHGPRNKPESGKFAREAGAKTVTINDIREAKDIRKLAADLYDQASEGVDVVYLSVCSD
VLDFAFNPGGPVDGNGLTSYELLTLIYEFTKRGIVGMDFVEVYPQQDPTNVSSHFASMIA
LYALAGVVEHQKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaatatttacggaaatacccctccatttttaggagcgattaatggaacgacg
gaatcaacggaagactcggatgtattaatctacggtgtcccttgggaaggtgctgttaca
tggggcgattacacaggctgtgagttggggccgaaagtaatgcgcttatgctcaggccga
tacagcggatacttgcctgagcttgatcatatcgatgtattcgagcacttgaagcttgcg
gatatgggcgatgtggatgtcgttcctgcagatgtaattgagacgatgaaccggattgag
tcgttttcaggcgatatgtgggattccggaaaattcccgctcgcgcttggcggcgaccac
ggcatcacctacccgattgttaaagcattaaccgagcgcacgggtaagaaagtcggcatt
cttcacttagatgctcactatgataatatgccgcatcacgacggtgataaatatgcccgt
tcgacaccatttgcgagactttatgagcttgatggtgtcagaaatgaaagcttaattcat
gccggaatccacggaccgcgcaacaagccagagagcggcaagtttgcacgagaggctggt
gcgaagacggttacgatcaatgatatccgcgaagcaaaggatattcgtaagcttgcggca
gacttgtatgaccaagcaagcgaaggtgtagatgttgtctacctttcagtatgcagtgac
gtactcgactttgcctttaatccaggtgggccagttgacggaaacggcctcacgtcatat
gagctgcttacgttaatttatgaatttacaaagcgcggcattgttgggatggactttgtt
gaggtgtacccgcagcaggacccaacgaatgtatccagccactttgcttcgatgattgct
ctttacgccctagcaggtgtggtggagcaccagaagaaataa

DBGET integrated database retrieval system