KEGG   Bacillus pseudofirmus: BpOF4_06190Help
Entry
BpOF4_06190       CDS       T01165                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpf  Bacillus pseudofirmus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpf00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3521041..3522963
Genome map
AA seq 640 aa AA seqDB search
MCGFIGCMYNKPKEMNADIKNQFVEMNSIITHRGPDDEGYYIDDYVHFGFRRLSIVDLES
GHQPLSYENERYWIIFNGEIYNHIELRKQLLNKGFNFSTHSDTEVLLALYSHYKEECVSK
LRGMFAFVIWDKVEQKLFGARDYFGIKPFFYSEENGLTYFASEEKSILLALKGELNHISL
QHYLSYQYVPEPETIMVQIKKLPPGHYFTQSPGGKLNIKSYWKPEFTSTQQTEHEKINQI
RNALIDSVNVHMRSDVPVGSFLSGGIDSSFIVSLAKEVNPALKTFSVGFGVDGFSEINVA
EETADALNLENINYLITPEEFLAEIPKIIWHMDDPLADPAAVPLYFVAREARKHVKVVLS
GEGADELFGGYNIYREPQSLRMFNYIPNPIKHILLRLSRILPEGFKGKSFIERGVTPLEE
RYIGNAKIFGETEKKILLNHYNPEFDYKSITRPIYNQSAGYDPVTKMQNIDIHTWLRGDI
LVKADKVTMAHSIELRVPFLDKHVFEVASRLSSEDKINHKTTKYLMRKAAEGIVPDRILN
RRKLGFPVPLRHWLKNELYDWAKNLITISQVDYIFNKQEIYKLLDEHVNNKRDNSRKLWV
ILMFMTWHQIYIEGEYDITKLATQKEQNNNHVEDSSLINV
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttattggttgtatgtataataaacctaaagagatgaatgcggatataaag
aatcaatttgtagaaatgaattcgatcattacacatagagggccggatgatgagggctat
tatatagatgactacgttcattttggattcagaagactaagtatagtggatttagagagt
ggacatcaaccgctttcttatgaaaatgaaagatattggatcatattcaatggagaaatc
tataaccatattgaacttcgtaaacaattacttaataaaggctttaacttttcaactcac
tctgatacagaagtccttcttgctctttatagccattataaagaagagtgtgttagtaag
ttaagagggatgttcgcttttgttatatgggataaagtggagcaaaaattgtttggagca
agagactattttggtattaaacctttcttttattcggaagaaaacggtctaacatacttc
gcatctgaagaaaagagtatcctattagctttgaaaggtgagttaaatcacatatccttg
caacactatcttagctatcagtatgtacctgaacctgaaacgattatggtacaaataaaa
aaattaccaccgggtcattattttacgcaaagtcctggaggtaaattgaatattaaaagc
tattggaagccagaatttacctcaactcaacaaacagagcatgaaaaaatcaatcaaatt
cgtaatgcacttatagattcagtaaacgtgcatatgcgtagtgatgttccagtaggctca
tttttatcaggaggtattgattcttccttcattgtttctttagcaaaagaagtgaatcct
gctcttaagacattttccgttggttttggagtagatggattcagtgaaattaatgttgcc
gaagaaacagcagacgcactaaatttggaaaatatcaactacctaattacaccagaagag
tttttggctgaaatcccaaagattatttggcacatggatgatcctctcgcagatccagca
gctgtacctttgtactttgtagcgcgggaagcgagaaaacatgtgaaagttgttttgtct
ggagaaggtgcggacgagctctttggagggtataatatatatcgtgagccacaatctcta
aggatgtttaattatattcctaatccaataaagcatatactactcagattgagccggatt
ctaccagaaggctttaaagggaagagttttatcgaacgaggagtgactcctctagaagaa
cgatatatagggaatgccaaaatatttggtgaaacagaaaaaaagattttgttaaatcat
tacaacccggaatttgattataaaagtattactagaccaatatataatcaatcagctggt
tatgacccagtaactaaaatgcaaaatattgacatacacacttggttacgtggagacatt
ttggtgaaagcagataaagtgactatggcccattcgatcgagttaagggttccttttttg
gataaacatgtttttgaagtagcttctagacttagcagtgaggacaaaataaatcataag
acaacaaaatatctaatgagaaaagccgctgaagggattgtcccagatcggattcttaat
cgaagaaagttggggttcccagttcctctccgtcattggcttaaaaatgagttatacgac
tgggcaaaaaatttaattactataagccaagtagattacatctttaataagcaagagatc
tacaagttattagatgagcatgtgaataacaaaagagataatagtcgaaaactatgggtg
atcttaatgtttatgacctggcaccaaatttatattgaaggtgaatatgatatcaccaag
ctagctacgcaaaaagaacagaacaataaccatgttgaagattcatcgttaatcaatgtg
taa

DBGET integrated database retrieval system