KEGG   Bacillus pseudofirmus: BpOF4_06350Help
Entry
BpOF4_06350       CDS       T01165                                 

Gene name
rbsK
Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BpOF4_06350 (rbsK)
Enzymes [BR:bpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BpOF4_06350 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase DUF2683
Motif
Other DBs
NCBI-ProteinID: ADC49330
UniProt: D3FZT8
Position
complement(3546081..3547010)
Genome map
AA seq 309 aa AA seqDB search
MNQRPKVTVIGSSNVDYVVRASKYPKVGETIIGSEFTQFMGGKGANQAVAAARLGADVTF
ITAIGEDSQGSEIKDNLLKENVNVEGIHKDTDESSGIAFINVSDDTNKITVIPGANYKLK
PEHIEIQKTAISSADIVLIQMEIPIDTVIKAMEVACEFNIPIILNPAPAQILSEELLGKA
TYLTPNVTEMQVITGLPLSNQQSIQDGFSLLFNQRVKNIILTRGEEGVLFGSHDEPLLRE
VQSMKVHPVDTTGAGDTFNGGLAYSLACGNDLEAAIQFANVAAALSVTKHGAQSGMPTLK
EVNAFALKQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaggcctaaagtaacggttattggaagttcaaacgttgattatgtggtccgt
gcctcaaagtaccctaaagttggagagacaatcattggatctgagttcacacagttcatg
ggtggcaagggtgcgaaccaggctgtagctgcagctagacttggtgctgacgttacgttc
atcacagcaattggagaggatagccaagggagcgaaattaaagataatttacttaaagag
aatgttaatgttgaaggaatccataaagacacagacgagtcaagtggaattgcctttatc
aatgtgtcagatgatacaaataaaattactgttataccaggagctaattataagctgaag
cctgaacatatagagattcaaaagactgctatatcttctgctgatatagttcttattcaa
atggagatcccaattgatacagttataaaagcaatggaggttgcatgcgaatttaatatt
ccgattattctgaacccagctcctgctcaaatcctttctgaagaactgttgggcaaagcg
acgtatttaacacccaatgttacagaaatgcaggttattacggggttacctttaagcaat
caacagagtattcaagatggtttttctcttctcttcaaccagagagtgaaaaatataatc
cttactaggggggaagaaggggtgttgtttggcagtcatgatgagccactgctgcgcgaa
gttcagagtatgaaggtccatccagttgataccaccggtgctggtgatacttttaacggg
gggcttgcctactcactcgcatgtggtaatgatcttgaggcagctattcaatttgcgaac
gtagcagccgcactttcagtaacgaaacatggtgcacaatcaggaatgccgacgttaaaa
gaagtgaatgcatttgctttaaaacaatga

DBGET integrated database retrieval system