KEGG   Bacillus pseudofirmus: BpOF4_08065Help
Entry
BpOF4_08065       CDS       T01165                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bpf  Bacillus pseudofirmus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bpf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33440..34036
Genome map
AA seq 198 aa AA seqDB search
MQYPEPIAKLIEGFMKLPGIGPKTASRLAFFVLDMKEDDVLDFAKALVNAKRNLTYCSVC
HNITDTDPCRICEDKHRDDSMVCVVQEAKDVIAMEKMKEYRGHYHVLHGAISPMDGIGPE
DVKIPELLKRLQDDTIQEVIIATNPTIEGEATAMYISRLVKPTGIKVTRIAHGLPVGGDL
EYADEVTLSRAIEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatatccagaaccaatcgcaaagttaattgaaggatttatgaaactgccaggtatc
ggaccgaaaacggcgagccgcctggctttctttgttttagatatgaaggaagatgatgtc
ttagatttcgcaaaagctcttgtaaatgctaagcggaatttaacgtattgctcggtttgt
cataatattactgatacggacccttgccgtatatgtgaggataaacatcgagatgattct
atggtttgtgttgtccaagaagcgaaagatgtgatcgctatggaaaagatgaaggagtat
cgtggtcattaccatgtcttacatggtgcgatctctccaatggacggcataggacctgag
gatgtcaaaatcccagaactattaaagcggctgcaagacgataccattcaagaggtaatc
attgctaccaacccgactattgaaggggaagcaacggcgatgtatatatcgcgtcttgtt
aagcctaccggtattaaagtgacgagaattgcgcacggactgccagttggtggagatcta
gaatatgctgatgaagtgacattatctagagcaattgaaggtagaagagaattgtag

DBGET integrated database retrieval system