KEGG   Bacillus pseudofirmus: BpOF4_08360Help
Entry
BpOF4_08360       CDS       T01165                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase (dihydropteroate pyrophosphorylase)
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00790  Folate biosynthesis
bpf01100  Metabolic pathways
Module
bpf_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BpOF4_08360 (folP)
Enzymes [BR:bpf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BpOF4_08360 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADC49730
UniProt: D3FR34
Position
92244..93026
Genome map
AA seq 260 aa AA seqDB search
MGKRTKIMGILNATPDSFSDGGKYNDVEAAKRRALEMIVQGADIIDIGGESTRPGFEKVE
ADEELARVIPVIEAVRGVTDVPISIDTYKAYVAREAIKAGATIINDVWGAKADPLMAQVA
ADTGVEIILMHNRDNTEYTDLLLDMKQDIEESIALCHQAGVKDEKIILDPGIGFAKTYEQ
NLEVMRRLDEFTALGYPVLLGTSRKRFIAKTLDLPVDERVEGTGATVCLGIAKGCEIVRV
HDVLEMSRMAKMMDAMLGGE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaaacgtacaaaaattatggggattttgaatgcaaccccagattccttttctgat
ggcggtaaatataacgatgtcgaagcagctaaaagaagagcgttggaaatgattgtgcaa
ggtgctgatattattgatattggtggagaatcaactcgtcctggctttgaaaaagtcgag
gcagatgaagagcttgccagagtcattccggtcattgaagcggtaagaggtgtaacggat
gttccgatctctattgatacgtacaaagcgtacgtagctcgggaagccattaaggcgggt
gcgacgatcattaatgatgtatggggagctaaggctgatccactgatggctcaagtagca
gctgacactggtgttgaaattattttgatgcacaatcgtgacaatacagagtacacagat
ctacttctagatatgaaacaagatatagaagagagtatcgctttatgccatcaagctggc
gtaaaagatgagaaaattattttagatccgggcatcggcttcgctaaaacgtacgagcaa
aatcttgaagtgatgcgcaggcttgatgaatttactgctttagggtaccccgttctttta
ggcacttctagaaaaaggtttattgcaaaaacattagacctccctgttgatgaacgtgtt
gaaggaactggcgctacggtatgcttaggtatagctaaaggctgtgaaattgtacgtgta
catgatgttcttgaaatgagcagaatggcaaagatgatggatgcaatgctgggaggcgaa
tga

DBGET integrated database retrieval system