KEGG   Bacillus pseudofirmus: BpOF4_09070Help
Entry
BpOF4_09070       CDS       T01165                                 

Gene name
subE
Definition
extracellular alkaline serine protease subtilisin E
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bpf  Bacillus pseudofirmus
Brite
Enzymes [BR:bpf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BpOF4_09070 (subE)
Peptidases [BR:bpf01002]
 Serine Peptidases
  Family S8: subtilisin family
   BpOF4_09070 (subE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
230333..231457
Genome map
AA seq 374 aa AA seqDB search
MNLQKIRSALKVKQSALVSSLTILFLIMLVGTASANGAKQEYLIGFNSDKAKGLIQNAGG
EIHHEYTEFPVIYAELPEAAVSGLKNNPHIDFIEENEEVEIAQTVPWGIPYIYSDVVHRQ
GYFGNGVKVAVLDTGVAPHPDLHIRGGVSFISTENTYVDYNGHGTHVAGTVAALNNSYGV
LGVAPGAELYAVKVLDRNGSGSHASIAQGIEWAMNNGMDIANMSLGSPSGSTTLQLAADR
ARNAGVLLIGAAGNSGQQGGSNNMGYPARYASVMAVGAVDQNGNRANFSSYGSELEIMAP
GVNINSTYLNNGYRSLNGTSMASPHVAGVAALVKQKHPHLTAAQIRNRMNQTAIPLGNST
YYGNGLVDAEYAAQ
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcaaaaaatacgctcagcgttgaaggttaagcaatcggcattggtcagcagt
ttaactattttgtttctaatcatgctagtaggtacggctagtgcaaatggtgcgaagcaa
gagtacttaattggtttcaactcagacaaggcaaaaggacttatccaaaatgcaggtgga
gaaattcatcatgaatatacagagtttccagttatctatgcagagcttccagaagcagcg
gtaagtggattgaaaaataatcctcatattgattttattgaggaaaacgaagaagttgaa
attgcacagacagttccttggggaatcccttatatttactcggatgttgttcatcgtcaa
ggttactttgggaacggagtaaaagtagcagtacttgatacaggagtggctcctcatcct
gatttacatattagaggaggagtaagctttatctctacagaaaacacttatgtggattat
aatggtcacggtactcacgtagctggtactgtagctgccctaaacaattcatatggcgta
ttgggagtggctcctggagctgaactatatgctgttaaagttcttgatcgtaacggaagc
ggttcgcatgcatccattgctcaagggattgaatgggcgatgaataatgggatggatatt
gccaacatgagtttaggaagtccttctgggtctacaaccctgcaattagcagcagaccgc
gctaggaatgcaggtgtcttattaattggggcggctggaaactcaggacaacaaggcggc
tcgaataacatgggctacccagcgcgctatgcatctgtcatggctgttggagcggtggac
caaaatggaaatagagcgaacttttcaagctatggatcagaacttgagattatggcgcct
ggtgtcaatattaacagtacgtatttaaataacggatatcgcagtttaaatggtacgtca
atggcatctccacatgttgctggggtagctgcattagttaaacaaaaacaccctcactta
acggcggcacaaattcgtaatcgtatgaatcaaacagcgattccgcttggtaacagcacg
tattatggaaatggcttagtggatgctgagtatgcggctcaataa

DBGET integrated database retrieval system