KEGG   Bacillus pseudofirmus: BpOF4_10250Help
Entry
BpOF4_10250       CDS       T01165                                 

Gene name
putP3
Definition
peptidase, ArgE/DapE family protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bpf  Bacillus pseudofirmus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BpOF4_10250 (putP3)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BpOF4_10250 (putP3)
Enzymes [BR:bpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BpOF4_10250 (putP3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
478397..479554
Genome map
AA seq 385 aa AA seqDB search
MSVTEVVSLTRELIQIPSENPTGNELACARYIESWLRRINGIEVSVHEVEEGRCNIIAAY
HASVKTSRPLVFIGHMDTVPVEGDWTYHPFGGQIVDGKLYGRGACDMKSGLACALMALKN
LAEEKVELERDVVVIASIDEEGPYMKGAVSLEKEHLIPEDALLVAMEPTSLTMSTSHKGT
IWYELNVEGKSAHGGNAHLGADAVHAASEVISRLKQQVAALPYDHPVFGKPAISVGSISG
GHKTNMVAGSCRVELDFRLVPPMTKEEANSIMKACVREGCESVPGTKALIKHYGWQRPPI
ETDANSPLVKMLAQSYEKVKGERIKETGFPAYTDVSMISLRNGNKDIIVFGPGDLDQAHA
VDEYVEIDQLEVCTEVLMELARSQE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtaacagaagtcgtaagcttaacaagggaactcattcaaattccttctgaaaac
ccaactggaaatgagttggcatgcgcgagatatattgaatcatggttaaggagaatcaat
ggaattgaagtgagtgttcacgaagtagaagagggacggtgtaatattattgctgcttat
cacgcctctgtgaagacgagtcgtcccctcgtcttcattggtcatatggatacggtgccg
gttgaaggtgattggacgtaccatccttttggcggacaaattgtggatggaaagctttat
ggaagaggcgcttgtgatatgaaaagcggtttagcttgtgccttaatggctttaaaaaat
ctagctgaagaaaaagtagaactagagcgtgatgttgttgtgatcgcaagtattgatgaa
gaaggtccttatatgaagggagctgtctcccttgaaaaagaacatctcattccagaggat
gctctattagtagcaatggagccaacgagtctcaccatgtcgacctcacataaaggaacc
atttggtatgaattgaatgttgagggaaagagtgcgcacggcggaaacgctcacttagga
gcagatgctgtacatgccgcttctgaagtgatcagccgcttaaagcagcaggtggcagca
cttccttatgatcatccggtattcggtaagccggcgatatcagtcgggagtatcagcggg
gggcataaaacgaatatggtcgcagggtcatgccgggtcgagctggacttccgcctcgtc
ccaccgatgactaaggaagaagcaaattcgattatgaaagcatgtgtaagggaaggatgc
gagtccgttccaggaacgaaagcactcatcaagcattacggctggcaaaggccgcctatt
gagacggatgctaacagcccgcttgttaaaatgcttgcacagagctatgaaaaagttaaa
ggcgagcgtatcaaggaaacgggatttcctgcttatacagatgtcagcatgatcagctta
cgaaatggaaataaggacattattgtctttggaccaggtgatttagatcaagcacacgct
gtggatgaatatgttgaaattgatcagcttgaagtttgtacagaggtattaatggaattg
gcccgatcacaagagtga

DBGET integrated database retrieval system