KEGG   Bacillus pseudofirmus: BpOF4_10360Help
Entry
BpOF4_10360       CDS       T01165                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bpf  Bacillus pseudofirmus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bpf00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bpf00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
505831..506313
Genome map
AA seq 160 aa AA seqDB search
MSTVHDFTVQSTKGEEVSLSTYKGQIMLIVNTATKCGLAPQFKGLEKLHQQYKDKGLAVL
GFPCNQFMNQEPVSDEQMTEACEINFGVTFPLFAKINVNGSDAHPLYKHLKKEQKGLLSS
EIKWNFTKFLVDKNGEVVKRFGPNTSPEKMEDEIKELLGQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccgtacatgactttactgttcagtcgactaaaggagaagaagtctctttatcg
acttacaaaggtcaaataatgctaattgtaaatacagcgacaaaatgcggccttgctcca
cagtttaaagggttagaaaagcttcatcagcagtacaaagacaaaggactggcagtgctc
ggctttccgtgcaaccagtttatgaatcaagagcctgttagtgatgaacaaatgacagaa
gcttgtgagatcaatttcggggtgactttcccgctatttgcgaaaattaatgtgaacgga
tcggatgcccatccactttacaaacatcttaaaaaagaacaaaaaggtctgctcagctca
gaaatcaaatggaactttactaaattcttagttgataaaaatggtgaagtcgtcaaacgg
tttggaccgaatacttctcctgagaaaatggaagatgaaattaaggaattattagggcaa
taa

DBGET integrated database retrieval system