KEGG   Bacillus pseudofirmus: BpOF4_11320Help
Entry
BpOF4_11320       CDS       T01165                                 

Gene name
acsA
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpf  Bacillus pseudofirmus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BpOF4_11320 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BpOF4_11320 (acsA)
   00620 Pyruvate metabolism
    BpOF4_11320 (acsA)
   00640 Propanoate metabolism
    BpOF4_11320 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BpOF4_11320 (acsA)
Enzymes [BR:bpf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BpOF4_11320 (acsA)
Lipid biosynthesis proteins [BR:bpf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BpOF4_11320 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
711963..713912
Genome map
AA seq 649 aa AA seqDB search
MSETVWHPTKEYIESTRLYQWMNKLGYSDYDTFFNKTVEDVAWFWHEAEKELEIPWYEPY
TKSLNDANGIEWPIWFEEGTLNASHLSIGKWAEDPSMKDKKALVWEGEDGAVRTFTYIEM
QEEVDRVAGGFRKLGLKKGDVVGIYMPMLPETVIAMMAASKIGAVFAPVFSGYGAEAVAT
RLNAGEAKALITADGFLRRGKTVMMKEEADRAADLSPTVEKVIVISRLNADTPWNDERDV
DWQEMRNSEKYEQTERMDSQEPLMLLYTSGTTGKPKGAVHTHSGFPIKAAFDAGIGMDVK
REDVLFWYTDMGWMMGPFLVYGGLVNGATILLYEGTPDFPNPDRIWELVAKHNVSHLGIS
PTLIRSLMTQGDEWVNKHSLDTLRVVGSTGEPWNPEPWMWLFQNVGKKQIPIFNYSGGTE
IAGGILGNVLVRPIGPITFNSPLPGMAADVFDPTGKPVENEVGELVIKKPWVGMTKGFWG
DSERYLNTYWSRFEQTWVHGDWVIKDTEGQWTITGRSDDILNVAGKRLGPAEVESVLVGH
EAVKEAGTIGIPDEVKGEAAICFAVLNQSQEPSEALKKELLSLVAEKLGKALKPKNLYFV
SDLPKTRNAKVMRRAIKAAYLGLETGDLSALENPQVLREIEQVKENVNL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagactgtctggcatccaacgaaagaatatattgagtcaacacgactttatcaa
tggatgaacaaattaggatacagcgattatgatacgtttttcaataaaacggttgaagac
gtagcatggttttggcatgaagcagaaaaagaattagaaattccttggtatgagccctat
accaaatcattgaatgatgcaaacggcatagaatggccgatttggtttgaagaaggtacc
ttaaatgcatctcatctctccattggaaaatgggcagaagatccttccatgaaagataaa
aaagcgcttgtttgggaaggcgaagacggggcagttagaacctttacatatatagaaatg
caagaggaagtggaccgtgtagcaggaggcttccgcaagctgggcctgaaaaagggcgat
gttgttggaatctatatgcctatgctgccagaaacggtgattgcgatgatggctgcttca
aagattggtgcagtgttcgccccggtattttcaggctatggcgcagaagcagtggcaact
aggcttaatgcgggagaggctaaagctcttattacagcagatggatttttaagacgtggg
aagactgtaatgatgaaggaagaagctgaccgtgcagctgacttatctcccacagtggaa
aaagtgatcgtcatcagccgtctgaatgccgatactccgtggaatgatgaacgggatgtt
gattggcaggaaatgcgtaactctgagaaatatgagcagacagaacggatggacagccaa
gaacctcttatgcttttatatacgtcagggacaaccggtaagccaaaaggggcagtgcat
acacatagcggcttcccgattaaagcggcatttgacgctggaattgggatggatgtaaaa
agagaagatgttcttttctggtataccgatatgggctggatgatggggccttttcttgtt
tacggtggtttagttaatggagcaacaattctgttatatgaaggcacacctgatttccca
aatcccgaccgtatatgggaacttgtggcgaagcataacgtcagccatcttggtatttca
cctacgttaatacgatctttaatgacgcaaggcgatgagtgggtcaataagcattcctta
gatacactgcgggtagtaggatcaacaggtgaaccgtggaatcctgagccgtggatgtgg
ctttttcagaatgtcggaaaaaaacaaattcctatttttaattattctggcggcacagaa
attgccggtgggatcttggggaatgtactcgtcagaccaataggaccaatcacttttaac
tccccgttacccggaatggcagcagatgtatttgacccaaccggaaagcctgttgaaaat
gaagtaggcgaactcgtaattaaaaagccgtgggtagggatgacaaagggattctggggt
gactcggaacgttatttaaacacctactggagccgattcgagcaaacgtgggtacacgga
gactgggtgattaaagatacggaggggcaatggacgattaccggcagatcggatgatatt
ttaaatgttgccggcaaacgcttaggtcctgctgaagtagaatcagtccttgtcggccat
gaggcagtgaaggaagcaggtacaatcggaattcctgatgaagtaaaaggagaagctgcg
atatgctttgctgttctaaaccaatctcaagaacctagtgaggcactaaaaaaagaattg
ttaagtctagttgctgaaaagctaggaaaggcgcttaagccaaaaaatttatactttgtc
agtgacctgccgaaaacaagaaatgcaaaagtaatgcgcagggcaattaaggccgcttat
ttaggattagaaacaggagatttatctgctctagagaatcctcaagttttacgcgaaatt
gagcaggtaaaagaaaatgtaaatttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system