KEGG   Bacillus pseudofirmus: BpOF4_11320Help
Entry
BpOF4_11320       CDS       T01165                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00010  Glycolysis / Gluconeogenesis
bpf00620  Pyruvate metabolism
bpf00640  Propanoate metabolism
bpf00680  Methane metabolism
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01120  Microbial metabolism in diverse environments
bpf01130  Biosynthesis of antibiotics
bpf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BpOF4_11320 (acsA)
   00620 Pyruvate metabolism
    BpOF4_11320 (acsA)
   00640 Propanoate metabolism
    BpOF4_11320 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BpOF4_11320 (acsA)
Enzymes [BR:bpf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BpOF4_11320 (acsA)
Lipid biosynthesis proteins [BR:bpf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BpOF4_11320 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADC50317
UniProt: D3FVB6
Position
711963..713912
Genome map
AA seq 649 aa AA seqDB search
MSETVWHPTKEYIESTRLYQWMNKLGYSDYDTFFNKTVEDVAWFWHEAEKELEIPWYEPY
TKSLNDANGIEWPIWFEEGTLNASHLSIGKWAEDPSMKDKKALVWEGEDGAVRTFTYIEM
QEEVDRVAGGFRKLGLKKGDVVGIYMPMLPETVIAMMAASKIGAVFAPVFSGYGAEAVAT
RLNAGEAKALITADGFLRRGKTVMMKEEADRAADLSPTVEKVIVISRLNADTPWNDERDV
DWQEMRNSEKYEQTERMDSQEPLMLLYTSGTTGKPKGAVHTHSGFPIKAAFDAGIGMDVK
REDVLFWYTDMGWMMGPFLVYGGLVNGATILLYEGTPDFPNPDRIWELVAKHNVSHLGIS
PTLIRSLMTQGDEWVNKHSLDTLRVVGSTGEPWNPEPWMWLFQNVGKKQIPIFNYSGGTE
IAGGILGNVLVRPIGPITFNSPLPGMAADVFDPTGKPVENEVGELVIKKPWVGMTKGFWG
DSERYLNTYWSRFEQTWVHGDWVIKDTEGQWTITGRSDDILNVAGKRLGPAEVESVLVGH
EAVKEAGTIGIPDEVKGEAAICFAVLNQSQEPSEALKKELLSLVAEKLGKALKPKNLYFV
SDLPKTRNAKVMRRAIKAAYLGLETGDLSALENPQVLREIEQVKENVNL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagactgtctggcatccaacgaaagaatatattgagtcaacacgactttatcaa
tggatgaacaaattaggatacagcgattatgatacgtttttcaataaaacggttgaagac
gtagcatggttttggcatgaagcagaaaaagaattagaaattccttggtatgagccctat
accaaatcattgaatgatgcaaacggcatagaatggccgatttggtttgaagaaggtacc
ttaaatgcatctcatctctccattggaaaatgggcagaagatccttccatgaaagataaa
aaagcgcttgtttgggaaggcgaagacggggcagttagaacctttacatatatagaaatg
caagaggaagtggaccgtgtagcaggaggcttccgcaagctgggcctgaaaaagggcgat
gttgttggaatctatatgcctatgctgccagaaacggtgattgcgatgatggctgcttca
aagattggtgcagtgttcgccccggtattttcaggctatggcgcagaagcagtggcaact
aggcttaatgcgggagaggctaaagctcttattacagcagatggatttttaagacgtggg
aagactgtaatgatgaaggaagaagctgaccgtgcagctgacttatctcccacagtggaa
aaagtgatcgtcatcagccgtctgaatgccgatactccgtggaatgatgaacgggatgtt
gattggcaggaaatgcgtaactctgagaaatatgagcagacagaacggatggacagccaa
gaacctcttatgcttttatatacgtcagggacaaccggtaagccaaaaggggcagtgcat
acacatagcggcttcccgattaaagcggcatttgacgctggaattgggatggatgtaaaa
agagaagatgttcttttctggtataccgatatgggctggatgatggggccttttcttgtt
tacggtggtttagttaatggagcaacaattctgttatatgaaggcacacctgatttccca
aatcccgaccgtatatgggaacttgtggcgaagcataacgtcagccatcttggtatttca
cctacgttaatacgatctttaatgacgcaaggcgatgagtgggtcaataagcattcctta
gatacactgcgggtagtaggatcaacaggtgaaccgtggaatcctgagccgtggatgtgg
ctttttcagaatgtcggaaaaaaacaaattcctatttttaattattctggcggcacagaa
attgccggtgggatcttggggaatgtactcgtcagaccaataggaccaatcacttttaac
tccccgttacccggaatggcagcagatgtatttgacccaaccggaaagcctgttgaaaat
gaagtaggcgaactcgtaattaaaaagccgtgggtagggatgacaaagggattctggggt
gactcggaacgttatttaaacacctactggagccgattcgagcaaacgtgggtacacgga
gactgggtgattaaagatacggaggggcaatggacgattaccggcagatcggatgatatt
ttaaatgttgccggcaaacgcttaggtcctgctgaagtagaatcagtccttgtcggccat
gaggcagtgaaggaagcaggtacaatcggaattcctgatgaagtaaaaggagaagctgcg
atatgctttgctgttctaaaccaatctcaagaacctagtgaggcactaaaaaaagaattg
ttaagtctagttgctgaaaagctaggaaaggcgcttaagccaaaaaatttatactttgtc
agtgacctgccgaaaacaagaaatgcaaaagtaatgcgcagggcaattaaggccgcttat
ttaggattagaaacaggagatttatctgctctagagaatcctcaagttttacgcgaaatt
gagcaggtaaaagaaaatgtaaatttataa

DBGET integrated database retrieval system