KEGG   Bacillus pseudofirmus: BpOF4_11840Help
Entry
BpOF4_11840       CDS       T01165                                 

Gene name
recD_traA
Definition
ATP-dependent exoDNAse V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bpf  Bacillus pseudofirmus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BpOF4_11840 (recD_traA)
Enzymes [BR:bpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BpOF4_11840 (recD_traA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
807290..809608
Genome map
AA seq 772 aa AA seqDB search
MDEQQSLEQDNGIERGYIKGEVLHLVFRNDENAYTVALIRVSETNEELKDKKITVVGILP
QLDVAETFLFFGTITDHPRFGQQYQVEQFRRDLPQTKNGIIQYLSSDRFPGIGKRTAETI
VEVLGERAITRIVEDRAVLKAVPKLSKEKADQLYQQLIDQQGVEQVLMTLSKHGFGLELS
MKVYQKYGFQALDIIQTNPYQLIADVEGIGFRKADLLGAAIGLTGNHPDRIRAGLLFVVQ
ELCLQDGHVYIEKEELIPHVKQLLSSPDASISTEEVEHELLTMEEEDALVLEETRVYIKS
LYFAEKGIVSSVRRLMATEVKDEFPESEFLKTLGELEEELKIEYAPQQKEAIQTALANPF
MLLTGGPGTGKTTVIKGIVETYARLNGLSLDPKAYTKSNPFPILLVAPTGRAAKRMSEAT
ELPAVTIHRLLGWKGGNGGFEKGEHEQLEGELIIVDEVSMVDIWLANQLLKAIPKGMQVV
FVGDQDQLPSVGPGQVLKDFLDAEVVPTVPLTAIYRQKEGSSIIELAHEMKQGKMPSDLP
EAKPDRRFFPCTTDHVQHVVTQICENAIKKGYLARDIQVLAPMYKGQAGITELNRILQEL
FNPKTEQKRELLYGELAYRTGDVVLQLVNNPDENVYNGDRGEIVAIFYAKENTEKQDQVV
ISFDGTEVVYNKKDLNQITHAYCCSIHKSQGSEFPIVVMPVVRNYSRMLRRNLIYTGITR
AKKFLLLCGELKSFHTAVTREDELIRYSMLKDKLVSLKQSQQEYENGNGQLT
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacaacaatccttagaacaagataacggaatagagcgtggctatataaaaggc
gaggttctccatctcgtctttagaaatgatgaaaatgcctacactgtagctctgattcgg
gtcagtgaaacaaatgaagagctaaaggataagaaaataacggtagtgggaatccttccg
cagctggatgtagcagaaacctttttgttttttgggaccatcactgaccatccacgtttt
ggacagcagtatcaagtagagcaatttagacgagatctgcctcaaacaaagaacggcatc
attcaatatctttcaagtgatcgcttccctgggatcggcaagaggacagcagaaacgatt
gttgaggtattaggggaaagggccattactcggattgttgaagaccgagctgtactaaaa
gctgtaccaaagctctctaaagaaaaagcagaccaattatatcagcagctcatagaccaa
caaggagttgaacaggtcctaatgacgctgtcaaagcacggatttggtcttgaactatca
atgaaggtatatcaaaagtatgggtttcaagcacttgatattattcaaacaaatccttat
cagctgattgcagatgtagaagggatcggatttaggaaggctgatttacttggagctgcg
attggtttaacagggaatcacccagacaggatccgagcggggcttttgtttgttgtacaa
gaattatgcttacaagatggacatgtctatatcgaaaaagaagaattgatccctcatgta
aaacaactgttatcgtcaccagatgcatcaataagtacagaagaagtcgagcatgagctt
ttaacgatggaagaggaggatgcgcttgtacttgaggaaacgcgcgtctatataaaatca
ctgtattttgctgaaaaaggaattgtctcaagtgtaaggagactcatggctacagaggtt
aaggatgaattcccggaatcggagttcttaaaaacactaggcgagcttgaggaagagtta
aaaattgaatacgcaccgcagcagaaagaagcgattcaaacagcgttagctaatcctttt
atgctccttacaggggggccgggaacgggaaagacaaccgttattaaaggaattgtcgaa
acgtatgcaaggcttaacggtttatcacttgaccctaaagcgtacactaaatccaatcca
tttccaatcttacttgtcgcaccaactggaagagcggcaaagcggatgagcgaggcaaca
gaactgcctgctgttaccattcataggctgcttggctggaaaggcggaaatggtggattt
gaaaaaggagaacatgagcagctggaaggagaattgattattgtcgatgaggtttcaatg
gttgacatctggcttgctaatcaattgttaaaggcgatccctaaaggcatgcaggtcgtt
tttgtaggagatcaagatcaattgccttcagttggacctggccaagtacttaaagacttc
ttagatgcagaggtcgttccaacagttccgttaacagcgatctatagacaaaaggaaggc
tcctcgatcatcgaactcgcccacgagatgaaacaagggaaaatgcctagcgacctgcct
gaagcgaagcctgatcgacggttctttccgtgtacaaccgatcacgtccagcatgttgtg
acacagatttgtgaaaatgctataaaaaaagggtatcttgccagagacatacaagtgctg
gctccgatgtataaagggcaggctgggattacagaactcaatcgtattctccaggagctt
ttcaaccctaagacagagcaaaaacgagagcttttatacggggaacttgcttaccggaca
ggagatgttgtacttcagcttgtaaacaatcctgatgaaaatgtgtacaacggagaccgc
ggagaaattgtggcgattttctatgcaaaagaaaatacagaaaaacaagatcaggttgtg
attagttttgatggaacagaggttgtctacaataagaaagatttaaatcaaattacacat
gcttattgctgttcgatccataaatcgcaaggaagcgaatttccaatcgttgtcatgcct
gtagtacgtaattattctcggatgctgaggagaaatttaatttatacagggattactcgg
gcaaaaaaattcctgcttctatgcggcgaattaaaatcctttcataccgcagttacacga
gaagatgagttaatcaggtattcgatgttaaaagacaagcttgtctccctaaaacaatct
caacaggaatatgagaatggaaatggtcaactaacataa

DBGET integrated database retrieval system