KEGG   Bacillus pseudofirmus: BpOF4_12605Help
Entry
BpOF4_12605       CDS       T01165                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bpf  Bacillus pseudofirmus
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BpOF4_12605
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BpOF4_12605
   00650 Butanoate metabolism
    BpOF4_12605
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BpOF4_12605
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BpOF4_12605
   00622 Xylene degradation
    BpOF4_12605
   00621 Dioxin degradation
    BpOF4_12605
Enzymes [BR:bpf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BpOF4_12605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
956157..957047
Genome map
AA seq 296 aa AA seqDB search
MSKINVAIIGTGNIGTDLMLKLERSDTLELKALIGIDPESDGVFRAIERGYQTFTHGLED
FLQSNGEMADIFFDATSAKAHVRHAKLLKEAGKQVLDLTPAARGPFVVPPVNLDSNLDVP
NINLITCGGQATIPMVHAVNRISPVEYAEIVATISSKSAGPGTRANIDEFTQTTKRGIEE
IGGAKQGKAIIILNPAEPPILMRDTVYAVVEEGKLNKEKIKESVNQMVTSVQSYVPGYRL
RSEPIFEGNRVTIFLEVEGAGDYLPEYSGNLDIMTAAAVKVAEELALNKLNNSAVL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataaatgtagcgattatagggaccggtaatataggaacagatttaatgttg
aaattagaacgctcagacacattagaattaaaagcattgattggaattgatcctgaatca
gatggtgtttttcgtgcgattgaacgcggttaccaaacctttacgcacggtttagaagat
ttcttgcaatctaatggggagatggctgatatcttttttgatgcgacatcagccaaagct
cacgttcgacatgccaaattattaaaagaagcaggcaaacaagtactagacttaacaccg
gctgcacgcgggccatttgttgttcccccagttaatttagattcaaatttagatgtgccg
aatattaatctaattacatgcggaggtcaggcaacaattccgatggttcatgctgtaaat
cgaatctcgccagttgagtatgctgaaattgtagctacgatctctagtaaaagtgcgggg
ccgggaacaagagctaacattgatgaatttacccaaacgactaagcgagggattgaagaa
attggaggggctaaacaagggaaggctattattattttaaatccagcagagcctccgatt
ttaatgagagatacggtatatgcggttgttgaagaaggcaagctcaataaagagaaaata
aaggaatctgttaatcaaatggttacaagtgtccaatcatatgtgccaggttaccgtttg
aggtctgagccgatatttgagggaaatcgagtaacaatctttttagaggtagaaggagca
ggtgattatttacctgaatactctgggaacttagatattatgactgcagcagctgtaaaa
gtggctgaagaacttgctttgaataaacttaataattccgctgttctataa

DBGET integrated database retrieval system