KEGG   Bacillus pseudofirmus: BpOF4_14010Help
Entry
BpOF4_14010       CDS       T01165                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bpf  Bacillus pseudofirmus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BpOF4_14010 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BpOF4_14010 (glcK)
   00052 Galactose metabolism
    BpOF4_14010 (glcK)
   00500 Starch and sucrose metabolism
    BpOF4_14010 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BpOF4_14010 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BpOF4_14010 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BpOF4_14010 (glcK)
Enzymes [BR:bpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BpOF4_14010 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1225227..1226216
Genome map
AA seq 329 aa AA seqDB search
MSTTTKKWYVGVDLGGTTIKMAFITSYGEIVSKWEIPTNTEDGGIHITMDIAKSIDHKLN
ELNQEKEHLAAIGMGAPGFIEMETGFIYQAVNIGWKDFPLKDRLEVETGLPVTVDNDANI
AALGEMWRGAGDGAKNLLCVTLGTGVGGGIIANGQILHGASGMAGEIGHITSVTKGGAPC
NCGKTGCLETIASATGIARLATEAVAVSNEPSLLKEQFDTLGSLTSKDVFEALAKGDHLA
ERVLDETASYLGVAIANLSNALNPEKIVIGGGVSKAGDALLEPLRTYFNQYALERVASSA
EFKIATLGNDAGVIGGAWLAKQKLNQTHY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgagtacaacgacgaaaaaatggtatgtaggtgttgacctaggcgggacaacaattaag
atggcgttcattacttcatacggtgaaattgtatcaaaatgggaaatcccaacaaatacc
gaggatggcggaattcatatcacgatggatattgcaaaatccattgatcataaattgaac
gagctaaaccaagaaaaagaacatttagcagcgatcggcatgggggcccctggctttatt
gaaatggaaacaggatttatctatcaagctgttaacattgggtggaaagacttccctctt
aaagaccggcttgaagtggaaacaggccttcctgtgacagttgataatgatgcaaatatc
gcagcattaggagagatgtggcgcggtgctggtgatggtgccaaaaatcttctttgcgtt
acgcttggaacaggtgttggtggcggtattatcgctaatggacaaatccttcacggtgct
agcgggatggctggagagatcggccatattacatctgttacaaagggtggtgctccgtgt
aattgcgggaaaacaggctgcttagaaacgattgcttctgcaacaggtattgcccggctt
gctactgaggcagttgccgtatcaaatgaacctagtttattaaaggaacagtttgataca
ttaggttctttaacttcaaaagatgtatttgaagcacttgctaaaggcgatcatttagca
gaacgagtattggatgaaacggcttcttatcttggcgtagcaatcgcgaacctttcaaat
gcactaaatccagagaaaattgtcattggcggcggagtatcaaaagctggcgatgcatta
cttgagccactaagaacctattttaatcagtatgcattagaacgtgtggcgagcagtgcc
gagtttaaaattgcgactttaggtaatgatgcaggtgtaatcggcggtgcttggctggct
aaacaaaagctgaatcagacacattattaa

DBGET integrated database retrieval system