KEGG   Bacillus pseudofirmus: BpOF4_14485Help
Entry
BpOF4_14485       CDS       T01165                                 

Gene name
asnO
Definition
(GenBank) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00250  Alanine, aspartate and glutamate metabolism
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BpOF4_14485 (asnO)
Enzymes [BR:bpf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BpOF4_14485 (asnO)
Peptidases [BR:bpf01002]
 Cysteine Peptidases
  Family C44
   BpOF4_14485 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase DUF1933 ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: ADC50946
UniProt: D3FZ77
Position
1310196..1312043
Genome map
AA seq 615 aa AA seqDB search
MCGITGWIDWRRDMRKEEAEVLKMAETLNRRGPDDMNVWTSKHVGFGHARLIVVDPEGGI
QPMSRTYKNKTYTICYNGELYNTEDIRKELLSAGHDFSGHSDTEVLLKSYIEWGYQCLEK
LNGIFAFAIWNDQDESLFMARDRLGVKPLFYTVRNGCLLFGSELKALLAHRDIEPVVDRE
GIAEIMGLGPSRTPGHGVFKDINELRPAHMLIYDRNGAKISRYWTLKSKPHPHSMEETAA
HIRELMEDIVERQLFADVPVGLFLSGGVDSSALTALAAKVHDKQGLGAVRSYSVDYDEND
KYFKANDFQPNADGPWIKLVSDSFKTKHYNAIISIDELANQLKEAVRVRDLPGMADIDSS
LLWFCREIKKDVTVGLSGECADEIFGGYPWFHKPEIMNVDMFPWMRSIDERQDLLNEKWQ
KKINLKRYVYDRYKETISETPRFNGDTKEEARRREISYLNIIWFMTNLLDRKDRMSMGAS
LEVRVPFSDHRLVEYVWNIPWEMKQLGGREKGILRKSLEGLLPDEILYRKKSPYPKTHHP
SYTEAVQKGIQEILDHDDSPIFEFINKEKLRQIADSGGLSTGTPYFGQLMAGPQLLAHFI
QMDFWLREYGVKIEG
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattactgggtggattgactggcggcgcgatatgagaaaagaagaagcggaa
gtattaaagatggctgaaaccctcaatagaaggggtccagatgatatgaatgtgtggact
tctaagcatgtgggctttggtcacgcaaggcttattgttgttgacccagaaggcggaata
cagccgatgagcagaacgtataaaaataaaacctatacgatatgttataacggtgaatta
tacaatacagaagatattcgtaaagagctgctatcagctggtcatgactttagcggccat
tccgacactgaggtattattgaagtcctatattgaatggggttatcaatgcctcgagaaa
ttaaatggaatttttgcatttgctatttggaatgatcaagatgaaagtctgtttatggca
agagatagacttggagtgaagcccctgttttacaccgtacgaaacggatgtttactattt
ggttcggagttgaaagcactcctggctcaccgtgatatagagcctgttgttgacagggaa
ggtattgcagaaattatggggctaggtccgtcgcgaacacctggtcatggggtgttcaaa
gatataaatgagcttcgacctgctcacatgttaatttatgaccggaatggtgcgaaaatc
agccgttactggacacttaaaagtaaaccccacccccattcaatggaggaaaccgctgca
catattcgtgaattaatggaagatattgtagagagacaattatttgctgacgtaccagtc
ggtttatttttatctgggggggtagattcaagtgcattaacagctctagctgcaaaagta
catgataagcaaggcttgggtgctgttcgaagttattcggttgattatgatgaaaatgat
aaatactttaaagcaaatgattttcagccaaatgcagacggcccctggataaagctcgtt
tctgattcatttaaaacaaagcattataatgccattatttctattgatgaactagcaaat
caactgaaagaagctgttcgggtacgggatttaccgggcatggcagatatagattcatct
cttctatggttttgcagggaaataaagaaagatgtgacagtggggctctctggcgaatgt
gcggatgaaattttcggaggatacccgtggtttcataaacctgagatcatgaatgttgat
atgtttccatggatgcgctccattgatgagcggcaagatttattaaatgaaaaatggcag
aagaaaattaatttaaaaagatatgtgtacgacaggtataaagaaacgatctctgaaact
ccaagatttaacggtgatacgaaagaagaggcaagaaggagagagatctcttatttaaat
atcatttggtttatgaccaatttattagatagaaaagatcgtatgagtatgggggcaagt
cttgaagttcgtgttccattttcagatcaccgcttagttgagtatgtatggaatatcccg
tgggagatgaaacaattaggcggaagagaaaaaggaattctgcgaaaatcattagagggc
ttattaccagatgagattttatatcgaaagaaaagtccttatcctaagacccatcaccct
agctacacagaagctgttcaaaaagggatccaagagattctagatcatgatgactcgccc
atttttgaatttattaataaagaaaagctgagacaaatagctgatagcggagggctttca
acaggcacaccttattttgggcagttgatggcaggaccgcagcttttagcacattttatt
cagatggacttttggctgagagaatacggagtcaaaatagaaggataa

DBGET integrated database retrieval system